KEGG   Xylanimonas cellulosilytica: Xcel_1674Help
Entry
Xcel_1674         CDS       T01135                                 

Definition
(GenBank) ATP dependent DNA ligase
Organism
xce  Xylanimonas cellulosilytica
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C PNKP_ligase RNA_ligase
Motif
Other DBs
NCBI-ProteinID: ACZ30697
UniProt: D1BSK5
LinkDB All DBs
Position
1813405..1814577
Genome map
AA seq 390 aa AA seqDB search
MPLPLTPPILPMLARSAPSVPDQPDDPSTPGTATRAWVYEPKWDGFRAIVYRDGDDVRID
SRNARPMQRYFPEVVEAVLAALPERCVVDGEIVVAQPGDGAGDLRRAHLDFEVLSQRIHP
AASRVRMLAESVPASLVVFDVLALDDADLTARPLRDRLAALDRLALTGPQVFATPRTTDA
AVAREWFERFEGAGLDGVVAKPLDGAYQPDKRAMLKVKHARTADVVLAGYRLHKTSTADR
PLIGSLLLGLHDDAGQLQFVGVAASFPASRRAALVEELASLVVQPGTPDHAAHPWGAWQD
PAAGDGTAGERRPGAQSRWSAGKDLSFTPLRAERVLEVGYDHMEGTRFRHTAQFKRWRPD
REPASCTFSQLEEPVGYDLASLLPGAPGTA
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgcccctgccgctgaccccgccgatcctgccgatgctggcccggtcggccccgtccgtc
ccggaccagcccgacgacccctcgacaccagggaccgccacccgggcgtgggtctacgag
cccaagtgggacgggttccgcgcgatcgtctaccgcgacggtgacgacgtgcgcatcgac
tcgcgcaacgcgcggcccatgcagcgctacttcccggaggtggtcgaggcggtcctcgcg
gccctcccggagcgttgcgtcgtcgacggcgagatcgtcgtcgcgcaacctggcgacgga
gcgggcgacctgcgccgcgcgcatctcgacttcgaggtgctgtcgcagcgcatccacccg
gccgcctcccgggtgcggatgctggccgagtccgtgcccgcgagcctggtcgtcttcgac
gtgctcgcgctcgacgacgccgacctcaccgcgcgcccgctgcgcgatcggctggccgcg
ctcgacaggctcgcgctcaccggcccgcaggtcttcgcgacgccgcgcaccaccgacgcc
gccgtcgcgcgcgagtggttcgagcggttcgagggggcgggcctggacggcgtcgtcgcc
aagcccttggacggcgcgtaccagccggacaagcgcgccatgctgaaggtcaagcacgcc
cgcaccgccgacgtcgtcctggcgggctaccggctgcacaagacgtcgacggcggaccgg
ccactgatcggctcgctgctgctggggctgcacgacgacgccgggcagctccagttcgtg
ggcgtcgcggcgtcgttcccggcgtcgcggcgggcggcgctcgtcgaggagctcgcctcc
ctggtcgtgcagcccggaaccccggaccatgccgcgcacccgtggggcgcctggcaggat
ccggccgccggtgacgggaccgcgggggagcgccgcccgggagcccagtcccgctggagc
gcgggcaaggacctgtcgttcacaccgctgcgggccgagcgggtgctggaggtggggtac
gaccacatggagggcacccggttccggcacacggcccagttcaagcgctggcggcccgac
cgggagccggcgtcgtgcaccttctcccaactcgaggagccggtcggctacgacctcgcg
tcgctgctgccgggtgcacccgggacggcctga

DBGET integrated database retrieval system