KEGG   Xylanimonas cellulosilytica: Xcel_2151Help
Entry
Xcel_2151         CDS       T01135                                 

Definition
(GenBank) Beta-galactosidase
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
xce  Xylanimonas cellulosilytica
Pathway
xce00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:xce00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    Xcel_2151
Enzymes [BR:xce01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Xcel_2151
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M Glyco_hydro_42C Glyco_hydro_35 Glyco_hydro_14 DUF4350 Glyco_hydro_2_C
Motif
Other DBs
NCBI-ProteinID: ACZ31169
UniProt: D1BUF6
LinkDB All DBs
Position
complement(2309800..2311857)
Genome map
AA seq 685 aa AA seqDB search
MNTPFSPGPDYTGWLPGLDAICYGGDYNPEQWPEEVWEQDVALMKEAGVNLVSIGIFSWA
LLEPRDGEFDFAWLDRLIELLHSHGIRVDLGTPTASPPAWFFRQYPESRVVTKNGTVLGF
GSRGMAAPSSSDYRRHAVRIATQLAERYGTHPALALWHVHNEYGAPVGEDFSAHAQRAWR
TWLRDRYVTLDALNAAWGTRFWGQVYGDWQEVGVPAATPSIANPAQRLDFARFTDAMLRE
CFVAERDAIRAHSTVPITTNFMAVACPATDLFAWGREVDIVSNDHYLWAADPRNYVTLAL
AADLTRSVAGGKPWMLLEHSTSGVNWQPRNVAKRAGEEQRNAFSHLGRGADAIMFFQWRA
SRSGAEKFHSAMIPHAGTNSRIWREVVSLGSVLGQLGELRGSRTQADVAILWDQESLWAQ
GLEWRPSEDLQAGERIQTFYDRLWRDGVTVDLAHPSSDLSAYRLVVAPASYLLTQASAAN
LTRYVEGGGTLLVSCFSGVVDEFDRVHEGGFMAPLRDALGVQVEELLPLREGESLSVVGL
SPSSDDEAAGAVTGTVWAEALMLGGAEVVGTYASGPAAGDAAITRHTHGAGTGWYLSTVL
DADALAPLMQRVYADAGVVPSDLPEDVEVLHRVGEGTEWTVAINHTDADAAVPVGTGAMD
ALSGAAVDGAVKVPAGEVRVLRRAR
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
atgaacaccccgttctccccaggcccggactacaccggctggctgcccggcctcgacgcc
atctgctacggcggcgactacaaccccgagcagtggcccgaggaggtctgggagcaggac
gtcgcgctgatgaaggaggcgggcgtcaacctcgtcagcatcggcatcttcagctgggcg
ctcctcgagccgcgggacggcgagttcgacttcgcctggctggaccgcctcatcgagctg
ctgcactcccacggcatccgcgtggacctgggcaccccgacggcgtcaccgcccgcgtgg
ttcttccgccagtaccccgagtcgcgcgtcgtcaccaagaacgggacggtgctcgggttc
ggctcgcgcggcatggccgccccgtcgtcgtcggactaccgcaggcacgcggtgcgcatc
gccacccagctcgcggagcgctacgggacgcaccccgcgctcgcgctgtggcacgtgcac
aacgagtacggcgccccggtgggcgaggacttctcggcccacgcgcagcgtgcatggcgg
acctggctgcgggaccgctacgtcaccctcgacgcgctcaacgcggcctggggaacacgg
ttctggggccaggtctacggcgactggcaggaggtcggtgtgccggccgcgacgccgtcg
atcgccaacccggcgcaacgcctggacttcgcccggttcacggacgcgatgctgcgcgag
tgcttcgtggcggagcgcgacgcgatccgcgcgcactccaccgtgccgatcacgacgaac
ttcatggccgtggcctgccctgcgacggacctgttcgcctggggccgcgaggtcgacatc
gtctcgaacgaccactacctgtgggccgccgacccgcgcaactacgtcaccctcgccctg
gccgcggacctcacgcgctcggtcgcgggcggcaagccgtggatgctgctggagcactcg
acgtcgggcgtgaactggcagccgcgcaacgtggccaagcgcgccggcgaggagcagcgg
aacgccttctcccacctggggcgcggcgccgacgcgatcatgttcttccagtggcgtgcc
tcgcgcagcggcgcggagaagttccactcggcgatgattccgcacgccgggacgaacagc
cggatctggcgtgaggtcgtgtccctggggtcggtgctggggcagctcggcgagctgcgg
gggtcgcggacccaggccgacgtcgcgatcctgtgggaccaggagtcgctctgggcgcaa
ggtctcgagtggcgtcccagcgaggaccttcaggccggcgagcgcatccagacgttctac
gaccgcctgtggcgcgacggcgtgaccgtcgacctcgcgcacccgtcgtccgacctgtcg
gcgtaccgcctggtggtggccccggcgtcgtacctgctcacgcaggcctccgcggcgaac
ctgacccgctacgtcgagggtggcggcacgctgctcgtctcctgcttctccggcgtggtc
gacgagttcgaccgcgtgcacgagggcgggttcatggccccgctccgtgacgcgctcggg
gtgcaggtcgaggagctcctgccgctccgggagggcgagtcgctctccgtcgtcgggctc
tcgccgtcgtccgacgacgaggcggcgggtgccgtgaccgggaccgtctgggcggaggcg
ctcatgctgggcggcgcggaggtcgtgggcacgtacgcgagcggcccggccgccggcgac
gccgcgatcacgcggcacacgcacggtgcggggacgggctggtacctctccacggtgctc
gacgccgacgccctggccccgctcatgcagcgcgtgtacgccgacgccggtgtggtgccg
tcggatctgccggaggacgtggaggtgctgcaccgcgtgggcgagggcacggagtggacc
gtggcgatcaaccacaccgacgcggacgccgcggtgcccgtcgggacgggtgcgatggac
gctctcagcggcgcggccgtggacggcgcggtcaaggttccggcgggtgaggtgcgggtg
ctccggcgcgcgcgctga

DBGET integrated database retrieval system