KEGG   Xylanimonas cellulosilytica: Xcel_2233Help
Entry
Xcel_2233         CDS       T01135                                 

Definition
(GenBank) DNA polymerase LigD, polymerase domain protein
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
xce  Xylanimonas cellulosilytica
Pathway
xce03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:xce00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    Xcel_2233
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:xce03400]
    Xcel_2233
Enzymes [BR:xce01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Xcel_2233
DNA repair and recombination proteins [BR:xce03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     Xcel_2233
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: ACZ31251
UniProt: D1BV12
LinkDB All DBs
Position
2411221..2413797
Genome map
AA seq 858 aa AA seqDB search
MGAPTTVTVDGHRLQLTNLDKVLYPATGTTKGEVIDYLARIAPVLLPHARRRPATRKRWP
DGVEGQVFFQKNADRSTPSWVRTHRIQHKTSANDYVLVDDVATLTWLGQTASLELHVPQW
QVGRTGTHLPPDRLVLDLDPGEGAGLPECAEVARLARAILQGMGLEPLPVTSGSKGIHLY
AALSAGSSPEGAKPSSAEQITDVAHELARYLEAEHPDLVVSDMKKSLRGGKVLVDWSQNN
GAKTTIAPYSLRGRTRPTVAAPRTWAELDDPDLRQLSYEEVLDRVARDGDLLAGLTAGHL
SQLEPTPAHLARFERLATYNAKRDPARTPEPFDTAPPAPVVEPVETTPPVGGVSTGSTTG
VGSTIGVGSTTGVGAPTFVIQEHHARRLHWDFRLERDGVLVSWALPKGEPTDPGTNHLAV
QTEDHPLAYGGFEGTIPNGEYGAGEVTIWDSGTYETEKWRDGKEVIAVLHSERRGTRRLA
LIRTGRAEGDNQWLIHRTKAQPAEDVASPAPVVEPVETTTPTRSTAEVAVRLEPMLASAA
QPAEVRALEADGESGSHDWVFEMKWDGYRTLAVVEPGPDGTRAIRLTSRTGQDFTRTYPE
LAPLAAQVTGELPVVLDAEIVALDAAGRPDFRRLQQHAGNVELMVFDVLQVGDRSLLHTP
YDERRTVLADVLDARRPVHLPAAFDGDLTAALETSRRLRLEGVMAKRRESTYQPGRRTRQ
WLKLKHTAVQEVVVVGWRPLRAGETDEDPRYAGGLLLAVPADDGALRYVGRVGTGFSDAE
RRDVATRLAAVERKTPPLDGVPRPDAAHTRWVTPRLVGEVEFAEWTGDPTDDPEARLRAA
RWRGWRPDKEPADVVVEP
NT seq 2577 nt NT seq  +upstreamnt  +downstreamnt
atgggcgcaccgacgacggtcaccgtggacgggcaccgcctccagctcacgaacctggac
aaggtgctctatccggccacgggcaccaccaagggcgaggtgatcgactatctcgcccgg
atcgcacccgtcctgctcccccacgcccggcggcgtcccgcgacgcgcaagcggtggccc
gacggcgtcgagggccaggtgttcttccagaagaacgccgaccgctccacgccgtcgtgg
gtgcgcacgcaccgcatccagcacaagacgtcggccaacgactacgtgctggtcgacgac
gtcgccacgctcacctggctggggcagacggcgtcgctcgagctgcacgtgccgcagtgg
caggtcgggcgcaccggcacccacctgccgccggaccggctggtgctcgacctggacccc
ggcgagggcgcgggcctgcccgagtgcgcggaggtcgcgcggctggcccgggcgatcctc
caggggatggggctggagccgctgccggtgacctccgggtcgaagggcatccacctgtac
gccgcactgtccgccgggtcctcccccgagggggcgaagccgtcctccgcggagcagatc
accgacgtcgcgcacgagctcgcccggtacctggaggccgagcaccccgacctggtggtc
agcgacatgaagaagtcgctgcgcggcggcaaggtgctcgtggactggtcgcagaacaac
ggggcgaagacgacgatcgcgccctactcgctgcgcgggcgcacccgtcccacggtcgcg
gcaccgcgcacctgggcggagctcgacgacccggacctgcggcagctctcgtacgaggag
gtgctggaccgggtggcccgcgacggcgacctgctggccgggctgacggcgggtcacctg
tcccagctcgagccgaccccggcgcacctggcccggttcgagcgcctggccacctacaac
gccaagcgggaccccgccaggaccccggaacccttcgacaccgccccacccgctccggtg
gttgagcctgtcgaaaccacgccaccggtgggaggggtttcgacaggctcaaccaccggg
gtgggctcaaccatcggggtgggctcgaccaccggggtgggcgcgcccaccttcgtgatc
caggagcaccacgcccgccgcctgcactgggacttccgcctcgagcgcgacggggtgctg
gtgagctgggcgctgcccaagggcgagccgaccgaccccggcacgaaccacctggccgtg
cagaccgaggaccacccgctcgcgtacggcggcttcgagggcaccatcccgaacggcgag
tacggggcgggcgaggtgaccatctgggactccggcacgtacgagaccgagaagtggcgc
gacggcaaggaggtcatcgccgtcctgcacagcgagcgccgcggcacccgccgcctcgca
ctgatccgcacgggccgcgcggagggcgacaaccagtggctgatccaccgcacgaaggcc
cagcccgccgaggacgtggcttcgccggccccggtggttgagcctgtcgaaaccaccacc
ccgacccgctcgaccgccgaggtcgcggtccggctcgaacccatgctcgcctccgccgcc
cagccggccgaggtccgcgccctggaggccgacggggagtcgggcagccacgactgggtg
ttcgagatgaagtgggacggctaccgcaccctcgccgtcgtcgaacccggccccgacggc
acgcgcgccatccgtctcacctcccgcacgggacaggacttcacgcgcacctacccggag
ctggcgccgctcgccgcgcaggtcaccggcgagctgccggtggtcctggacgccgagatc
gtcgccctcgacgccgcaggccgccccgacttccgccggctgcagcagcacgcgggcaac
gtcgagctcatggtcttcgacgtgctccaggtgggcgaccggtccctgctgcacaccccg
tacgacgagcgccgaaccgtgctggccgacgtcctcgacgcacgacgtccggtccacctg
cccgccgcgttcgacggcgacctgaccgccgcgctggagacctcgcgacgcctgcgcctc
gagggcgtcatggccaagcgccgtgagtcgacctaccagccgggccgccggacgcggcag
tggctcaagctcaagcacaccgccgtccaggaggtggtcgtcgtcgggtggcgtccgctg
cgcgcgggagaaaccgacgaggacccgcggtatgcgggcggcctgctgctcgccgtaccc
gccgacgacggcgccctgcgctacgtgggccgcgtcgggacggggttcagcgacgccgaa
cgccgcgacgtcgccacccgcctcgccgccgtcgaacgcaagacgccgccgctcgacggc
gtcccccggcccgacgccgctcacacccgctgggtcaccccgcggctggtcggcgaggtg
gagttcgcggaatggaccggcgacccgaccgacgaccccgaggcccggttgcgcgccgcc
cgctggcgcggctggcgcccggacaaggagcccgccgacgtcgtcgtcgaaccctga

DBGET integrated database retrieval system