KEGG   Xylanimonas cellulosilytica: Xcel_3285Help
Entry
Xcel_3285         CDS       T01135                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
xce  Xylanimonas cellulosilytica
Pathway
xce00620  Pyruvate metabolism
xce00680  Methane metabolism
xce01100  Metabolic pathways
xce01120  Microbial metabolism in diverse environments
xce01200  Carbon metabolism
Module
xce_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:xce00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Xcel_3285
  09102 Energy metabolism
   00680 Methane metabolism
    Xcel_3285
Enzymes [BR:xce01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Xcel_3285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 SnoaL Metal_hydrol
Motif
Other DBs
NCBI-ProteinID: ACZ32285
UniProt: D1BRL9
LinkDB All DBs
Position
complement(3646886..3649627)
Genome map
AA seq 913 aa AA seqDB search
MTAIRTIRHTLPIVSEIFPQATERVVARYEMPDPLRDDIRLLGGLLGTILKEAGGQDLLD
DVEHLRELTIRAYGDDAAALAAAAAHVNSLSLDRADQIARAFTCYFHLANLAEEYHRVRV
LRSRDQAVERSLVEETIPRAFNQLAEEVGRDEALRRLQELEFRPVLTAHPTEARRRAVSR
SIRRIGNLLADRDTLRPGGTALAEINRHLLAEIDVLWRTQPLRPAKPTVIDEVKSAVGVF
DQTLFQTFPEVYRRLDDWLLGDDAGRATPLVRPFVRLGTWIGGDRDGNPNVTADVTRQAA
AVAAEHALAALEDEAFSTARKLTMAAGDTPPSDALRGLWNRLRQLSGEAAARAEAESPGE
PHRAALLVIAERIAATRRRDADLAYPTAEKLEADLRVVQDSLVAAGAPRLAYGSLQKLIW
QVQTFGFHLAELEVRQHSQVHAEALAEIAEKGVNSPELSDRTREVLDTYRALGAVQARYG
ERAARRYIVSFTQAPEHLAAVYQLAELAFPDPDERPVIDAIPLFETFADLEGSVEILEAM
LELPQVQARLAVNGRKVEVMLGYSDSSKDVGPVAATLALHTAQSRIAEWADRHDIELTLF
HGRGGALGRGGGPANRAVLAQPPHSVDGRFKLTEQGEVILARYGDPVIAMRHIEQVAAAT
LLASAPSVEKRNASATERFRDLASALDVASRERFHALVRSEGFPQWFAQVTPLEEIGMLA
IGSRPAKRGLSVNSLDDLRAIPWVFSWSQARINLAGWYGLGTALRAYAESRPDGLAELQS
AFLEWPLFNTLLDNVEMSIAKTDERIAQLYLQLGDRPDLAQQVLDELRLTREWVLKVTGN
AWPLEGRRVLGRAVQLRSPYVDALSLLQVRALRALRTDGASEPSQDAAARRERWQHLLLL
TVNGVSAGLQNTG
NT seq 2742 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcgatccggacgattcggcataccctccctatcgtgagcgagatcttccctcaa
gccaccgagcgtgttgtcgcgcgctacgagatgcccgacccgctgcgggacgacatccgc
cttctgggcggcctgctgggcacgatcctcaaggaggccggcggtcaggacctgctcgac
gacgtcgagcacctgcgtgagctgacgatccgcgcgtacggggacgacgccgcagcgctg
gccgcggccgccgcgcacgtcaactccctgtcgctggaccgcgccgaccagatcgcccgc
gccttcacgtgctacttccacctggcgaacctcgccgaggagtaccaccgggtgcgcgtg
ctgcgctcccgcgaccaggcggtcgagcggtcgctggtcgaggagacgatcccgcgcgcg
ttcaaccagctcgcggaggaggtcggccgcgacgaggcgctgcgacgcctccaggagctc
gagttccggccggtgctcacggcccacccgaccgaggcgcgccgtcgggcggtgtcccgg
tccatccgccgcatcggcaacctgctggccgatcgcgacacgctgcgccccggcggcacc
gcgctcgccgagatcaaccgccacctgctcgcggagatcgacgtgctgtggcgcacccag
ccgctgcgcccggccaagccgaccgtcatcgacgaggtcaagtccgccgtcggcgtgttc
gaccagacgctgttccagaccttccccgaggtctaccggcgcctcgacgactggctgctg
ggcgacgacgccggccgcgccacccccctggtgcgcccgttcgtgcgcctgggcacctgg
atcggcggcgaccgtgacggcaaccccaacgtcaccgccgacgtcacccggcaggccgcc
gccgtcgccgccgagcacgccctcgcggcgctcgaggacgaggcgttcagcacggcccgc
aagctgacgatggccgccggcgacaccccgccgtcggacgccctgcgcgggctgtggaac
cgcctgcgccagctctccggggaggccgcggcgcgcgccgaggcggagtctccgggcgag
ccgcaccgcgcggcgctgctggtgatcgccgagcgcatcgccgccacccgacgccgcgac
gccgacctcgcctacccgacggcggagaagctggaggcggacctgcgcgtcgtgcaggac
tcgctcgtcgccgcgggcgccccgcgcctggcctacgggtccctgcagaagctcatctgg
caggtgcagaccttcgggttccacctggccgagctggaggtgcgccagcactcgcaggtg
cacgccgaggccctcgccgagatcgccgagaagggcgtcaacagcccggagctcagcgac
cgcacgcgcgaggtgctcgacacgtaccgtgcgctcggcgccgtccaggcgcgctacggc
gagcgggcggcgcgccgctacatcgtctcgttcacgcaggcgcccgagcacctggcagcg
gtctaccagctcgccgagctcgcgttccccgacccggacgagcgtccggtcatcgacgcg
atcccgctgttcgagaccttcgccgacctcgaaggctcggtggagatcctcgaggcgatg
ctcgagctgccgcaggtgcaggcgcgcctcgcggtcaacggccgcaaggtcgaggtcatg
ctcggctactccgactcctcgaaggacgtcggcccggtcgccgcgaccctcgcgctgcac
accgcgcagtcgcgcatcgccgagtgggccgaccggcacgacatcgagctcaccctgttc
cacggtcgtggcggcgccctcgggcgcggcggcggcccggccaaccgggcggtgctcgcg
cagccgccgcactcggtcgacgggcgcttcaagctcaccgagcagggcgaggtcatcctg
gcccgctacggcgacccggtcatcgcgatgcgccacatcgagcaggtcgccgccgcgacc
ctgctcgcctcggcaccctcggtggagaagcgcaacgcgtcggccaccgaacggttccgg
gatctcgcatcggcgctggacgtggcctcgcgcgagcggttccacgccctggtgcgctcc
gagggcttcccgcagtggttcgcccaggtgacgccgctggaggagatcgggatgctggcc
atcggctcgcgccctgccaagcgcggcctgtcggtcaactcgctcgacgacctgcgcgcc
atcccgtgggttttctcctggtcgcaggcgcgcatcaacctggccggctggtacggcctg
ggcacggcgctgcgcgcgtacgcggagtcccggcccgacgggctcgccgagctccagtcg
gcgttcctcgagtggccgctgttcaacacgctgctcgacaacgtcgagatgtccatcgcc
aagaccgacgagcgcatcgcccagctctacctgcagctcggtgaccgccccgacctcgcc
cagcaggtgctcgacgagctgcgcctgacgcgcgagtgggtgctcaaggtgacgggcaac
gcgtggccgctcgagggtcgccgcgtgctgggccgtgccgtgcagctccgctcgccgtac
gtcgacgccctgtccctgctccaggtgcgtgccctgcgcgcactgcggaccgacggcgcc
tccgagccgtcgcaggacgccgccgcccggcgcgaacgctggcagcacctgctgctgctc
accgtcaacggcgtctcggcgggcctgcagaacacgggctga

DBGET integrated database retrieval system