KEGG   Xanthomonas citri pv. citri mf20: J172_00234Help
Entry
J172_00234        CDS       T03781                                 

Definition
(GenBank) NAD-dependent aldehyde dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
xcf  Xanthomonas citri pv. citri mf20
Pathway
xcf00010  Glycolysis / Gluconeogenesis
xcf00620  Pyruvate metabolism
xcf01100  Metabolic pathways
xcf01110  Biosynthesis of secondary metabolites
xcf01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:xcf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    J172_00234
   00620 Pyruvate metabolism
    J172_00234
Enzymes [BR:xcf01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     J172_00234
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA
Motif
Other DBs
NCBI-ProteinID: AJZ06836
UniProt: A0A0U5FES8
LinkDB All DBs
Position
151958..153487
Genome map
AA seq 509 aa AA seqDB search
MNALASAKSLNNDPHSIFKPRYDNFIGGQWVAPHSGQYFDNTTPINGKVFTSIARSTAPD
IEAALDAAHAAKDAWGKTSTTERSNVLLKIADRIEQNLELLAYAETWDNGKPVRETLNAD
VPLCVDHFRYFAGAIRAQEGGISEIDSDTIAYHFHEPLGVVGQIIPWNFPLLMACWKLAP
ALAAGNCVVMKPAEQTPASILVLMELIGDLLPPGVLNVVNGFGLEAGKPLASNPRIAKIA
FTGETTTGRLIMQYASQNLIPVTLELGGKSPNIFFADVMAEDDDFLDKAVEGFVLFAFNQ
GEVCTCPSRALIQESIYDAFMEKALSRVAAIKQGNPLDPNTMVGAQASSEQLEKILSYID
IGKQEGAEVLIGGERNTLDGDLAEGFYVKPTVFKGHNKMRVFQEEIFGPVVSVTTFKDEA
DALAIANDTLYGLGAGVWSRDASRLYRMGRAIQAGRVWTNCYHAYPAHAAFGGYKQSGIG
RENHKMMLDHYQQTKNLLVSYSPKALGFF
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcgcttgcctctgcaaaatcgctcaacaacgatccgcactccatcttcaaaccg
cgctacgacaacttcatcggcggccagtgggtagcgccgcacagcggccagtacttcgac
aacaccacgccgatcaacggcaaggtctttacctcgatcgcgcgctccaccgccccggat
atcgaagcggcgctggatgccgcgcacgcggccaaggatgcgtggggcaagacctccacc
accgagcgctctaacgtattgctcaagatcgccgaccgcatcgaacagaatctcgaactg
ctcgcgtacgccgagacctgggacaacggcaagccggtgcgcgaaacgctcaatgccgac
gtgccgttatgcgtggaccacttccgctatttcgccggcgccatccgcgcgcaggaaggc
ggcatttccgagatcgacagcgacaccatcgcgtatcacttccacgaaccactgggcgtg
gtggggcagatcatcccgtggaatttcccgctgctgatggcgtgctggaaactcgcaccg
gcgcttgccgccggtaactgcgtggtgatgaagccggcagagcagacgcctgcctcgatc
ctggtgttgatggaactcatcggcgacctgctgccgcctggcgtgttgaacgtggtcaac
ggcttcggcctggaggccggcaagccgctggccagcaacccgcgcatcgccaagattgcg
ttcaccggcgaaaccaccaccggccggctgatcatgcagtacgccagccagaacctgatt
ccggtgacgctggagctgggtggcaaatcgcccaacatcttcttcgccgatgtgatggcc
gaagacgacgattttctcgacaaggcggtggaaggcttcgtgctgttcgctttcaaccag
ggcgaagtgtgtacctgcccgtcgcgcgcgctgatccaggagtccatctacgacgccttc
atggaaaaggcgctctcgcgcgtggccgcgatcaagcagggcaatccgctcgaccccaac
accatggtcggtgcgcaagcgtccagcgaacagttggaaaaaatcctctcctatatcgac
atcggcaagcaggaaggcgccgaagtgttgattggcggcgagcgcaacacgctcgatggc
gacctggccgaaggtttttacgtcaagcccacggtgttcaagggccataacaagatgcgc
gtgttccaggaggagatcttcggcccggtggtctcggtcaccaccttcaaggacgaagcc
gatgcgctggcgatcgccaacgacacgctgtacggcctgggtgccggtgtctggagtcgc
gacgcttcgcgcctgtatcggatgggccgtgcgatccaggctggccgcgtgtggaccaat
tgctatcacgcctatcctgcgcatgctgcattcggcgggtacaagcagtcgggtatcggc
cgcgagaatcacaagatgatgctcgaccactatcagcagaccaagaacctgttggtgagc
tattcgccgaaggcgctggggtttttctaa

DBGET integrated database retrieval system