KEGG   Xanthomonas citri pv. citri mf20: J172_00318Help
Entry
J172_00318        CDS       T03781                                 

Definition
(GenBank) Cu/Zn superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
xcf  Xanthomonas citri pv. citri mf20
Brite
Enzymes [BR:xcf01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     J172_00318
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu CHRD Big_3_5
Motif
Other DBs
NCBI-ProteinID: AJZ06920
LinkDB All DBs
Position
258126..258773
Genome map
AA seq 215 aa AA seqDB search
MRIVPTTLFLATALVLTACKRDEPAPAEPAPAPQASTPAEAAHGGEHAASMVTEAAATTT
ATAELKPTKGNDVKGTVTFKTVDGALRVTGQLSGLKPNTEHGFHIHEKGDCSAPDGSSAG
GHFNPSQSDHGNISADPHHGGDMPNITADAQGNASIDGPVSSNVNLGKADQFDIAGHAVI
VHADADDYKTQPTGNAGGRLACGVITTDNAQAPAK
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgcgtattgttccgaccaccttgtttctggccaccgccctggtgctgaccgcgtgcaag
cgcgacgaaccggcgccggccgagccggcacctgcaccgcaggccagcacgccggccgaa
gcggcgcacggtggcgaacacgccgcttccatggtcaccgaagcagcagccaccaccacc
gcaaccgccgagctcaagccgaccaagggtaatgacgtcaaaggcacggtgacgttcaag
accgtcgacggtgcgctgcgtgtcaccggccagctcagcggcctcaagcccaataccgag
cacggcttccacatccacgagaagggcgattgcagcgcaccggacggcagcagcgccggc
ggtcacttcaacccgtcccagtccgatcacggcaatatcagcgccgacccgcaccacggt
ggcgacatgcccaacatcaccgccgacgcgcagggtaacgccagcatcgacggcccggtc
tccagcaacgtcaacctcggcaaggccgaccagttcgatatcgccggccacgcggtgatc
gtgcatgccgatgcagacgactacaaaacccagcccaccggcaacgcgggcggccgcctg
gcctgcggcgtgatcaccactgataacgcgcaggcgccggccaagtaa

DBGET integrated database retrieval system