KEGG   Xanthomonas citri pv. citri mf20: J172_00844Help
Entry
J172_00844        CDS       T03781                                 

Definition
(GenBank) Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain
  KO
K02483  two-component system, OmpR family, response regulator
Organism
xcf  Xanthomonas citri pv. citri mf20
Brite
KEGG Orthology (KO) [BR:xcf00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:xcf02022]
    J172_00844
Two-component system [BR:xcf02022]
 OmpR family
  Unclassified
   J172_00844
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C MTD Colipase
Motif
Other DBs
NCBI-ProteinID: AJZ07443
UniProt: A0A0U5FC27
LinkDB All DBs
Position
complement(870641..871420)
Genome map
AA seq 259 aa AA seqDB search
MYPAATTLRGPSAAPQTMIPMDLQQPCVLVVDDDPDLRKLIGEFLSAHGYQVDMAENVAE
MRSVMAQRRPDLIVLDVMMPGEDGLSAARALASERGSPAVIMLSALGNDTDRIIGLEVGA
DDYLAKPCNPRELLARVRALLRRSQASNEQADQRGNVYEFAGWRLDVVRRDLRDPTGIFI
NLSDGEFALLRTFVEHPQRVLSRDQLLDYARGRDTDVYDRAIDSQISRLRRKINERVHTE
LIRTVRNEGYMLLPSVSRL
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgtatccggcagccaccaccttgcgcgggccaagcgccgcgccacagacgatgatccct
atggacctgcaacaaccctgcgttctcgtggtcgacgacgacccggacctgcgcaagctg
atcggcgaatttctgagcgcccacggctaccaggtggatatggccgaaaacgtggcggag
atgcgctctgtcatggcgcagcgccgcccggacctcatcgtactcgacgtgatgatgccg
ggagaagatgggctgagtgcagcgcgcgccctggccagcgagcgcggttcacctgcggtc
atcatgctcagcgcgctgggtaacgacaccgaccgcatcatcggcctggaagtcggcgcc
gacgattacctcgccaagccctgcaatccgcgcgaattgctggcgcgtgtgcgcgccctg
ctgcggcgcagccaggccagcaacgaacaggccgaccagcgcggaaacgtctacgaattc
gccggctggcggctggacgtggtacgccgcgacctgcgcgaccctaccggcatcttcatc
aatctgtccgacggcgagttcgcgctgctgcgcaccttcgtcgaacacccgcagcgcgtg
ctcagccgcgaccagttgctggactacgcccgtggccgcgacaccgacgtctacgaccgc
gccatcgacagccagatcagccgcctgcgccgcaaaatcaatgagcgcgtccataccgaa
ttgattcgcaccgtacgcaacgagggctacatgctgctgccgagcgtctcgcgcctgtga

DBGET integrated database retrieval system