KEGG   Xanthomonas citri pv. citri mf20: J172_02498Help
Entry
J172_02498        CDS       T03781                                 

Definition
(GenBank) thiol reductant ABC exporter, CydC subunit
  KO
K16012  ATP-binding cassette, subfamily C, bacterial CydC
Organism
xcf  Xanthomonas citri pv. citri mf20
Pathway
xcf02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:xcf00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    J172_02498
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:xcf02000]
    J172_02498
Transporters [BR:xcf02000]
 ABC transporters, eukaryotic type
  ABCC (CFTR/MRP) subfamily
   ABCC-BAC subgroup
    J172_02498
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran ABC_membrane AAA_16 AAA_21 AAA_29 CbiA DUF87 T2SSE NACHT AAA_18 AAA_22
Motif
Other DBs
NCBI-ProteinID: AJZ09051
UniProt: A0A0U5FHP5
LinkDB All DBs
Position
complement(2726963..2728648)
Genome map
AA seq 561 aa AA seqDB search
MSRAQPDRLRDVFGRHAWRLLLSAVLVLVTMLAGVGLLGLSGSFLTAAALAGVAGMGTGF
NFFSPSAGIRALTFARIVSRYGEKLIGHDATLRIARDLRVWFFRRALPLAPGRLSATRTG
DLLARLMSDIGEVDGLSVRALAPLAALLGIWLGGVVAAALIYLPAACLLLVLGVLIGGLV
PWQVARGGAQREQLRAQQRTTLRTQAFEGLEGAADLAAVHAQGAWLQRSDAAAAAVTGGD
HIQRRRLITGNLLHALCGGLGLAGMLWLALGAAERGLIAAELAAGLVFLTMALLEVWAGA
GLALQALQSARVAAGRLQAIVDQAPSVSDPAHAIDVPRTGTLQLQQVSFAWPGSVRPVLH
ALDLTLAPGERIAISGDSGSGKSTLSALLLRLWDPQAGQLRYAGIDLRHVAQAQWYQRIA
WLPQNAPVFAGSVRDNLLIGDATADDAALWQVLEQVRLGAWASANDGLDTWVGENGATLS
AGQARRLALARALLRDAPILLLDEPTDGLDVDTADALLRDLAAALGERSLAMITHDALPP
GVVQRHYRMREGTLELLDQNA
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgagccgcgcccagcctgatcgtctgcgcgatgtgttcggtcggcatgcctggcgcctg
ctgttgtcggcagtgctggtgctggtcaccatgcttgccggtgtcggcctgctgggcttg
tccggcagcttcctgaccgccgctgcgctggcaggcgttgccggtatggggaccggcttc
aatttcttctcgccgtcggccggcattcgcgccttgaccttcgcgcgtatcgtgtcgcgc
tacggcgaaaagttgatcgggcacgatgccaccttgcgcatcgcccgcgatctgcgggtg
tggttctttcgtcgcgccttaccgctggcacccgggcgattgtcggccacccgcaccggc
gatctgctggcgcggctgatgtccgacatcggcgaggtcgacggcctcagcgtgcgcgca
ttggcaccgctggccgcgttgctcggcatctggctaggcggtgtcgtcgctgctgcactg
atctatcttcccgctgcatgcttgttgttggtgctcggcgtgctgatcggtgggctggtg
ccgtggcaggtggcacgcggcggcgcgcagcgcgagcagttgcgtgcgcagcagcgcacc
accttgcgcacgcaggccttcgaaggcctggagggcgcggccgaccttgctgcggtgcat
gcgcagggcgcctggctgcagcgcagcgacgccgccgctgccgccgtcaccggcggcgat
cacatccagcgcagacggctgatcaccggcaacctgctgcatgcgctctgcggcgggctg
gggctggccggcatgctgtggctggcacttggcgcggccgaacgcgggctgatcgccgcc
gagcttgctgcggggttggtgtttttgaccatggcgttgctggaagtctgggccggtgcc
gggctggcgttgcaggcgctgcaaagcgcacgcgttgccgccgggcgcctgcaggccatc
gtcgatcaagcgccatcggtgagcgatccggcgcacgcaatcgacgtgccgcgcaccggc
acgctgcaattgcagcaggtgtcgtttgcctggcccggtagcgtgcgcccggtgctgcat
gcgctcgatctgaccctggcgccgggcgagcgcatcgccatcagcggcgacagcggcagc
ggtaaaagcacattgtcggcgttgttgctgcggctgtgggatccgcaggccgggcagctg
cgctacgccggcatcgacctgcgtcacgtcgcacaggcgcaatggtaccagcgtatcgcc
tggctgccccagaacgcgccggtgtttgccggcagcgtgcgcgacaacctgctcatcggc
gacgcgactgccgacgatgccgcgttgtggcaggtgctcgagcaggtgcgcctgggcgcg
tgggcgagcgcgaacgacggcctggacacctgggtcggtgaaaacggcgccacgctgtct
gccggccaggcgcgccggctcgccctcgcgcgggcactgctgcgcgatgccccgatccta
ttgctcgacgaacccaccgatggtctggacgtggataccgccgacgcgctgctgcgcgac
ctggccgccgcactcggcgaacgctcgctggcgatgatcacccacgacgcgctaccgccc
ggtgtcgtgcaacggcattaccggatgcgtgaaggaacgctggagctgctcgatcagaac
gcgtag

DBGET integrated database retrieval system