KEGG   Xanthomonas citri pv. citri mf20: J172_03187Help
Entry
J172_03187        CDS       T03781                                 

Definition
(GenBank) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
xcf  Xanthomonas citri pv. citri mf20
Pathway
xcf00400  Phenylalanine, tyrosine and tryptophan biosynthesis
xcf01100  Metabolic pathways
xcf01110  Biosynthesis of secondary metabolites
xcf01130  Biosynthesis of antibiotics
xcf01230  Biosynthesis of amino acids
Module
xcf_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:xcf00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    J172_03187
Enzymes [BR:xcf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     J172_03187
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_33 AAA_18 Cytidylate_kin2 Cytidylate_kin CoaE AAA_16 AAA AAA_17 Enkurin AAA_5 AAA_22 Mg_chelatase TsaE
Motif
Other DBs
NCBI-ProteinID: AJZ09729
LinkDB All DBs
Position
3520529..3521071
Genome map
AA seq 180 aa AA seqDB search
MNPAPNLVMVGPMGAGKSCIGRRLAERFGLEFVDVDQAIVEQVGSSIPAIFEQHGEARFR
QHEAETLQALLEQDNKLISTGGGAVLDPRNRERICARGFVVYLHVSVPAQLTRLARDRNR
PLLQRADREQVLHAMAAHRTPLYHQVADLSLETDHLSPAEATAQLVLRLAAQWRMSSNPA
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgaaccccgcacccaatctcgtgatggtcggcccgatgggcgccggaaaaagctgcatc
ggccgtcgcctggccgagcgcttcgggctggaattcgtcgatgtggaccaggccatcgtc
gaacaggtgggcagcagcatcccggccatcttcgagcagcatggcgaagccaggtttcgg
cagcacgaggcggaaaccctgcaggcgctgctggaacaggacaacaaactgatttccacc
ggtggcggcgcagtgctggatccgcgcaaccgcgagcgcatctgcgcgcgtgggttcgtg
gtgtacctgcatgtcagtgtgccggcgcaattgacacgcctggcgcgcgaccgcaatcgc
ccgctgctgcaacgcgccgaccgcgagcaggtgctgcatgcgatggccgcgcaccgcacg
ccgctgtaccaccaggtcgcagatctcagcctggaaaccgatcatctttcccccgccgaa
gccacagcgcagctggtgctgcgcctggccgcgcaatggcgcatgtcgagtaaccccgca
tga

DBGET integrated database retrieval system