KEGG   Xanthomonas citri pv. citri mf20: J172_03283Help
Entry
J172_03283        CDS       T03781                                 

Definition
(GenBank) penicillin-binding protein 1B
  KO
K05365  penicillin-binding protein 1B [EC:2.4.1.129 3.4.16.4]
Organism
xcf  Xanthomonas citri pv. citri mf20
Pathway
xcf00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:xcf00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    J172_03283
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:xcf01003]
    J172_03283
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:xcf01011]
    J172_03283
Enzymes [BR:xcf01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     J172_03283
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     J172_03283
Glycosyltransferases [BR:xcf01003]
 Polysaccharide
  Bacterial polysaccharide
   J172_03283
Peptidoglycan biosynthesis and degradation proteins [BR:xcf01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   J172_03283
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly UB2H Transpeptidase
Motif
Other DBs
NCBI-ProteinID: AJZ09824
UniProt: A0A0U5FGL5
LinkDB All DBs
Position
complement(3652451..3654895)
Genome map
AA seq 814 aa AA seqDB search
MPRRHDNDAPDDFEDDTNAQGSRWQRRLIVWGFAAFALALGFLIPYTVYLNKQVTQRFGE
LRWQIPTRVYGRPLVLVPGNALDAATLKTELDAASYRDDGQAKLAGTYQQDGSRFTIASR
GYIDVDGRVPARRIEVSLAGGRVASLRDAGDRKALKSARLDPARIATLYGQKQEERRLVR
MEEVPELLVTGLQAVEDRDFNSHHGIDLSGMVRAAWIMARSGGQVRQGASTLTQQLARSG
LLGIGKEQTLTRKFNEILYAVIMEARYDKRTILEAYLNQVYLGQRGGQAIHGVSSGAELW
FGRELNSMTTEQIALLIGLVKGPSYYDPRRNPERALDRRNFVLGKLHENNLINDAEYKRA
LAAPLGVPIEPGLVAANRFPAYVDLVRRQLAHDYPEGVLQGAGMSVLTGMSPSAQAYAEG
AVTGTIKRLDNKKRPPLQAGLVLTDVHNGDVLAVVGSRDVAKPGFNRAVEAQRQVGSLLK
PFVYMLALASPDRWALSSWVDDSPVTVQLSRGKTWSPGNSDNRSHGTVRLVDALAHSYNQ
ATVRVGMQVGADRIAQLIQVLAGIKAEPNPALILGTTDQSPYGMAQLYQFLAAGGEIQPL
HAVRGVLDPQGKLLKRYDKTPAPAQEGDSVAANLISIGLQQVVSGGTARQLLGDGLGRLS
SAGKTGTSNDGRDSWYAGYTGDHLAVIWMGNDQNAETGLYGATGAMRVWSSIFARLPSAP
LKVSGKGLDWQWVDASGTGVTDPGCPGARQFPFVVGFTPAYAPCAGNAPSIEAAPGEAAA
PAEQSSGGGWRRFFGLEKKPEDPAAAPAAAPPTR
NT seq 2445 nt NT seq  +upstreamnt  +downstreamnt
gtgccccgacgccacgacaacgacgctcccgacgatttcgaggacgacaccaacgcgcaa
ggctcccgctggcaacgcagactcatcgtctggggatttgccgcgttcgcgctggcgctc
ggtttcctgattccctatacggtgtatctgaacaagcaggtcacccagcgctttggcgaa
ctgcgttggcagatccccacccgcgtgtacggccggccgctggtgctcgtgccgggcaac
gcactggatgcggccacgctgaagaccgagctggacgcggcgtcgtaccgcgacgacggt
caggcgaagctggccggcacctaccagcaggacggcagccgcttcaccatcgccagccgc
ggctacatcgatgtggatggacgcgtgccggcgcgccgtatcgaagtcagcctggccggt
gggcgcgtggccagcctgcgcgacgccggcgaccgcaaggcgctcaagagcgcacgcctg
gacccggcgcgcatcgccaccctgtacgggcagaagcaggaagaacgccgcctggtgcgc
atggaagaagtgcccgagctgctggtcaccggcctgcaggcggtggaagaccgcgacttc
aacagccatcacggcatcgatctgagcggcatggtgcgcgcggcctggatcatggcgcgc
tccggcggccaggtccgccagggcgccagcaccctgacccagcagttggcccgtagcggc
ctgctcggcatcggcaaggaacagacgctcacgcgcaagttcaacgagatcctgtacgcg
gtgatcatggaggcgcgctacgacaagcgcaccatcctggaggcctatctcaaccaggtc
tatctgggccagcgcggcgggcaggcgatccacggcgtgtcgtcgggcgcggaactgtgg
ttcggtcgcgaactcaattcgatgaccaccgagcagatcgcattgttgatcgggctggtc
aaggggccgtcgtactacgacccgcggcgcaacccggaacgcgcgctggaccgacgcaat
ttcgtgctcggcaagctgcacgaaaacaatctgatcaacgacgccgaatacaagcgcgcg
ctggctgcgccgttgggcgtgccgatcgagcctggcctggtcgctgccaaccgttttccg
gcgtatgtggacctggtgcggcgccagctggcgcacgactatccggaaggcgtgctgcag
ggcgccggcatgagcgtgcttaccggcatgtcgccgtcggcgcaggcgtatgccgaaggc
gcagtgaccggcaccatcaagcggctggacaacaagaaacgcccgccgctgcaggcgggg
ttggtgcttaccgacgtgcataacggcgatgtgctcgccgtggtcggcagccgcgatgtg
gccaagccgggtttcaatcgtgcggtggaagcgcagcggcaggtgggctcgttgctcaag
ccgttcgtctacatgctggccttggcctcgccggaccgctgggcgctgtccagctgggtc
gacgactcgccggtgaccgtgcagctcagccgcggcaagacctggtcgccgggcaattcc
gacaaccgcagccacggcacggtgcgcctggtcgatgcgctggcgcattcctacaaccag
gccacggtgcgggtgggcatgcaggtcggcgcggaccgcatcgcgcagctgatccaggtg
ttggccggtatcaaggccgagcccaatccggcgctgatcctgggcaccaccgaccagagc
ccgtatggcatggcgcagctgtatcagttcctggcagccggcggcgagatccagccgctg
catgcggtgcgcggtgtgctcgacccgcaaggcaagctgctcaagcgctacgacaagacc
ccggcgccggcgcaggaaggcgattcggtggccgccaacctcatcagcatcggcctgcag
caggtggtcagcggcggcaccgcgcggcagttgctgggcgatggcctggggcgcctgtcg
tcggccggcaagaccggtacctccaacgacggtcgcgacagctggtatgccggctacacc
ggcgatcatctggcggtgatctggatgggcaacgaccagaacgccgaaaccggcttgtat
ggcgccaccggcgcgatgcgggtgtggtcgagcatcttcgcccgcctgccgagtgcgcca
ttgaaggtcagcggcaaaggtctggattggcagtgggtggacgccagcggcaccggcgtc
accgacccgggttgcccgggtgcgcgccagttcccgttcgtggtcggcttcacgccggcc
tacgcgccgtgcgcgggcaacgcgccgtcgatcgaagccgcgcccggcgaagcggccgca
cctgccgaacaatccagcggcggtggctggcgccgcttcttcggtctggaaaagaagccc
gaagaccctgccgccgcacctgccgcggccccacccacgcgttga

DBGET integrated database retrieval system