KEGG   Xanthomonas citri pv. citri mf20: J172_04315
Entry
J172_04315        CDS       T03781                                 

Definition
(GenBank) hypothetical protein
  KO
K11901  type VI secretion system protein ImpB
Organism
xcf  Xanthomonas citri pv. citri mf20
Brite
KEGG Orthology (KO) [BR:xcf00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:xcf02044]
    J172_04315
Secretion system [BR:xcf02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   J172_04315
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: AJZ10841
UniProt: A0A0U5FMN3
LinkDB
Position
complement(4874839..4875348)
AA seq 169 aa
MASSQKFIARNRAPRVQIEYDVEVYGAQKKVQIPFVMGVMSDLSGANAGELPSLDERKAL
EIDVDNFDSRLQSMGPRAQFKVPNTLTGEGELAVDITFESMDDFSPAAIARKVAPLAKLL
EARTQLANLDTYMDGKAGAEQLIANAIRDPALLQSLVSAGKPASEPEGT
NT seq 510 nt   +upstreamnt  +downstreamnt
atggccagcagtcagaagttcatcgcccgcaatcgggcgccacgggtgcagatcgaatac
gacgtggaggtctacggcgcgcagaagaaggtgcagattccgttcgtgatgggggtgatg
tcggatctgtccggcgccaacgccggtgagctgccctcgctggatgagcgcaaggcactg
gagatcgacgtcgacaacttcgacagccgtctgcagtcgatgggcccgcgcgcgcaattc
aaggtgcccaacacgctcaccggcgaaggcgagctggcggtggatatcaccttcgaaagc
atggacgacttttcgccggccgccatcgcgcgcaaggttgcgccgttggccaaattgctg
gaagcgcgcacgcagttggccaacctggacacctacatggacggcaaggccggtgcagag
cagctgatcgccaacgctatccgcgatccggcgttgctgcagtcgctggtgtcggccggc
aagcccgcgtccgaaccggaaggaacctga

DBGET integrated database retrieval system