KEGG   Xanthomonas citri pv. citri mf20: J172_04415Help
Entry
J172_04415        CDS       T03781                                 

Definition
(GenBank) Ribulose-5-phosphate 4-epimerase
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
xcf  Xanthomonas citri pv. citri mf20
Pathway
xcf00051  Fructose and mannose metabolism
xcf01100  Metabolic pathways
xcf01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:xcf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    J172_04415
Enzymes [BR:xcf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     J172_04415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II RTC
Motif
Other DBs
NCBI-ProteinID: AJZ10941
UniProt: A0A0U5FKN7
LinkDB All DBs
Position
complement(5007984..5008664)
Genome map
AA seq 226 aa AA seqDB search
MFAHEQRQRVVALCIELSRRGYLAGTGGNVALRIDAECFAVTPSAIDYLSMQAEDICIVR
TKDLHQLDGTRTPSVETGLHAQVMRRRPDVGCSIHTHQPVASACTLLGAPLEVTQPALRR
LLGARIPIAGYMPSGTGLLARLLARQLRPTVNAYLLRNHGVVCCGTNLQAAVTVVEALEL
VARSHLQTQIQARAAREPDLAAGLQRVLTALDSHRHTSGASSLSQT
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgtttgcccatgaacaacgccagcgcgtggtcgcgctgtgcatcgaactgtcgcgccgc
ggctatctggctggcaccggcggcaatgtcgccttgcgtatcgatgccgagtgtttcgcg
gtcaccccttcggcgatcgactacctgagcatgcaggccgaggatatctgcatcgtccgc
accaaggacctgcaccagctcgacggcacgcgtacgccgtcggtcgaaaccggcctgcat
gcgcaggtgatgcggcggcgcccggacgtgggctgcagcatccacacccaccagccggtc
gccagcgcctgcaccctgctgggcgcgccattggaggtgacgcaaccggcgttgcgccgg
ctgctcggcgcacggattccgatcgccggctacatgccgtcgggcaccggcctgctggcc
cgcctgctggcccggcagctgcggcccaccgtcaacgcctatctgctgcgcaatcacggc
gtggtctgctgcgggaccaacctgcaggcggccgtcaccgtggtcgaggcgttggagctg
gtcgcgcgcagccacctgcagacgcagatccaggcgcgtgcggcgcgcgagcccgacctc
gctgcgggcctgcagcgggtgctgacggcgctggattctcaccggcacacgtccggtgcg
tcctccctttcccagacatga

DBGET integrated database retrieval system