KEGG   Xanthomonas citri subsp. citri Aw12879: XCAW_00518Help
Entry
XCAW_00518        CDS       T02519                                 

Gene name
aldA
Definition
(GenBank) Chloroacetaldehyde dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
xci  Xanthomonas citri subsp. citri Aw12879
Pathway
xci00010  Glycolysis / Gluconeogenesis
xci00620  Pyruvate metabolism
xci01100  Metabolic pathways
xci01110  Biosynthesis of secondary metabolites
xci01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:xci00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XCAW_00518 (aldA)
   00620 Pyruvate metabolism
    XCAW_00518 (aldA)
Enzymes [BR:xci01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     XCAW_00518 (aldA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA
Motif
Other DBs
NCBI-ProteinID: AGI06337
LinkDB All DBs
Position
613473..615002
Genome map
AA seq 509 aa AA seqDB search
MNALASAKSLNNDPHSIFKPRYDNFIGGQWVAPHSGQYFDNTTPINGKVFTSIARSTAPD
IEAALDAAHAAKDAWGKTSTTERSNVLLKIADRIEQNLELLAYAETWDNGKPVRETLNAD
VPLCVDHFRYFAGAIRAQEGGISEIDSDTIAYHFHEPLGVVGQIIPWNFPLLMACWKLAP
ALAAGNCVVMKPAEQTPASILVLMELIGDLLPPGVLNVVNGFGLEAGKPLASNPRIAKIA
FTGETTTGRLIMQYASQNLIPVTLELGGKSPNIFFADVMAEDDDFLDKAVEGFVLFAFNQ
GEVCTCPSRALIQESIYDAFMEKALSRVAAIKQGNPLDPNTMVGAQASSEQLEKILSYID
IGKQEGAEVLIGGERNTLDGDLAEGFYVKPTVFKGHNKMRVFQEEIFGPVVSVTTFKDEA
DALAIANDTLYGLGAGVWSRDASRLYRMGRAIQAGRVWTNCYHAYPAHAAFGGYKQSGIG
RENHKMMLDHYQQTKNLLVSYSPKALGFF
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcgcttgcctctgcaaaatcgctcaacaacgatccgcactccatcttcaaaccg
cgctacgacaacttcatcggcggccagtgggtagcgccgcacagcggccagtacttcgac
aacaccacgccgatcaacggcaaggtctttacctcgatcgcgcgctccaccgccccggat
atcgaagcggcgctggatgccgcgcacgcggccaaggatgcgtggggcaagacctccacc
accgagcgctctaacgtattgctcaagatcgccgaccgcatcgaacagaatctcgaactg
ctcgcgtacgccgagacctgggacaacggcaagccggtgcgcgaaacgctcaatgccgac
gtgccgttatgcgtggaccacttccgctatttcgccggcgccatccgcgcgcaggaaggc
ggcatttccgagatcgacagcgacaccatcgcgtatcacttccacgaaccactgggcgtg
gtggggcagatcatcccgtggaatttcccgctgctgatggcgtgctggaaactcgcaccg
gcgcttgccgccggtaactgcgtggtgatgaagccggcagagcagacgcctgcctcgatc
ctggtgttgatggaactcatcggcgacctgctgccgcctggcgtgttgaacgtggtcaac
ggcttcggcctggaggccggcaagccgctggccagcaacccgcgcatcgccaagattgcg
ttcaccggcgaaaccaccaccggccggctgatcatgcagtacgccagccagaacctgatt
ccggtgacgctggagctgggtggcaaatcgcccaacatcttcttcgccgatgtgatggcc
gaagacgacgattttctcgacaaggcggtggaaggcttcgtgctgttcgctttcaaccag
ggcgaagtgtgtacctgcccgtcgcgcgcgctgatccaggagtccatctacgacgccttc
atggaaaaggcgctctcgcgcgtggccgcgatcaagcagggcaatccgctcgaccccaac
accatggtcggtgcgcaagcgtccagcgaacagttggaaaaaatcctctcctatatcgac
atcggcaagcaggaaggcgccgaagtgttgattggcggcgagcgcaacacgctcgatggc
gacctggccgaaggtttttacgtcaagcccacggtgttcaagggccataacaagatgcgc
gtgttccaggaggagatcttcggcccggtggtctcggtcaccaccttcaaggacgaagcc
gatgcgctggcgatcgccaacgacacgctgtacggcctgggtgccggtgtctggagtcgc
gacgcttcgcgcctgtatcggatgggccgtgcgatccaggctggccgcgtgtggaccaat
tgctatcacgcctatcctgcgcatgctgcattcggcgggtacaagcagtcgggtatcggc
cgcgagaatcacaagatgatgctcgaccactatcagcagaccaagaacctgttggtgagc
tattcgccgaaggcgctggggtttttctaa

DBGET integrated database retrieval system