KEGG   Xanthomonas citri subsp. citri Aw12879: XCAW_03774Help
Entry
XCAW_03774        CDS       T02519                                 

Gene name
ppc
Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
xci  Xanthomonas citri subsp. citri Aw12879
Pathway
xci00620  Pyruvate metabolism
xci00680  Methane metabolism
xci01100  Metabolic pathways
xci01120  Microbial metabolism in diverse environments
xci01200  Carbon metabolism
Module
xci_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:xci00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    XCAW_03774 (ppc)
  09102 Energy metabolism
   00680 Methane metabolism
    XCAW_03774 (ppc)
Enzymes [BR:xci01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     XCAW_03774 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase
Motif
Other DBs
NCBI-ProteinID: AGI09539
LinkDB All DBs
Position
complement(4207781..4210495)
Genome map
AA seq 904 aa AA seqDB search
MNEYRSSLVFATPDLPLRDDVRRLGALVGDLLAEQVSAEFLDEIERVRTTAISRRESDAP
PSTLSEQLAGRQPRDAEALVRAFSTYFQVVNIAERVHRIRRRREYQRSGTDTPQPDGLHD
ALRRLKAQGVTLDELSQWLPRIDVEPVFTAHPTEAVRRALLEKEQLMVASLVDNLDGMRT
PNERASDAARFRMALTASWQTADSSPVRPTVDDEREHVGFYLTQVLYRVIPVMYETLEHA
IEETYGSVPALPRLLRFGTWVGGDMDGNPNVDAKTIAGTLDAQRRAVLDRYQKELWQLAS
LLSQSTTLVQVSGELTAQLERYRALLPDAAARSRPRHGDMPYRLLNDLMRARLQATLDDA
DGAYAAPSELEHDLQLILDSLQANKGLHAGWFAARRLLWRVRSFGFHLARLDVRQESSVH
ARAVADALGQTDWDAQDATQRAAVLGPYAAGQDPLPRVDDEGNARLDAVFAALADARTRH
GADALGSYIISMAHNRADVLTVLALARRGGLVDDAGAVPLDIVPLFETVDDLRGGTGTVQ
DLLADPVYRQHLAARGDTQMVMLGYSDSGKDGGIAASRWGLQRAQVELLEAAAELGVRLT
FFHGRGGSIARGGGKTSRALDAAPRGSVDGRLRVTEQGEVIHRKYGIRALALRSLEQMTG
AVLLSSLRPRAPEPREARWRPVMDLVAERSTVAYRAFVGAPEFMQYFRLATPIDVIERMT
LGSRPSRRLGQDAALSNLRAIPWVFAWSQARAVIPGWYGVGSGLQAAVDAGHEETLREMA
QDWPFFRTFLDDIAMVLSKGDLNIAELFSRLSGDLHTRFFPLIRDELALTKGWVKALLQQ
QSLLQHDPRLALSIRLRNPYIDPISVLQVDLLQRWRATDGEDEALLRALVACVNGVSQGV
QNTG
NT seq 2715 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagtaccgcagcagtcttgtgttcgcgacccccgatcttcccttgcgcgacgat
gtgcgtcggctcggcgcgctggtgggtgatctgctcgccgagcaggtctctgcggaattc
ctcgatgaaatcgaacgcgtgcgcaccaccgccatctcgcggcgcgaaagcgatgcccca
ccgtccacgctgagcgaacaactcgccggtcggcagccgcgtgacgccgaagcgctggtc
cgggcattcagtacctatttccaggtggtcaatatcgccgagcgcgtgcaccgcatccgc
cgccgtcgcgaatatcagcgcagcggcaccgacacgccgcagcccgatggcctgcatgac
gcattgcgccggctcaaggcgcagggcgtgaccctggacgaactcagccaatggttgccg
cgcatcgacgtggagccggtgttcaccgcgcatcccaccgaggcggtacggcgcgcgctg
ctggaaaaagagcagctgatggtcgccagcctggtcgacaacctggacggcatgcgcacg
cccaacgagcgtgccagcgatgccgcgcgcttccgcatggccttgaccgcgtcgtggcag
accgccgattcctcgccggtgcgccccaccgtggacgacgagcgcgagcatgtgggcttc
tacctcacccaggtgctctaccgcgtcatcccggtgatgtacgaaacgctcgaacacgcc
atcgaagaaacctacggcagcgtgccggcattgccgcgtctgctgcgcttcggcacctgg
gtgggcggcgacatggacggcaatcccaacgtggatgccaagaccatcgccgggacgctg
gacgcgcagcggcgcgcggtgctggaccgttatcaaaaagaactctggcagttggccagc
ctgctcagccaatcgaccacgctggtacaggtgagcggcgaactcaccgcgcagctggaa
cgctaccgcgcgctgctccccgacgccgccgcgcgttcgcgcccgcgccatggcgacatg
ccgtaccgcctgctcaacgacctgatgcgcgcgcgcctgcaggccaccctggacgatgcc
gatggcgcctatgccgctccatcggagctcgaacacgatctgcagctgatcctggacagc
ctgcaggccaacaagggcctgcatgccggttggttcgcggcacggcgcctgttgtggcgc
gtgcgtagctttggtttccatctggcgcggctggacgtgcgccaggaatcgagcgtgcat
gcgcgcgcagtggccgatgccctgggccagaccgactgggacgcacaggacgccacccag
cgcgccgccgtgctcggcccgtatgccgcagggcaagaccccttgccgcgcgtggacgat
gaaggcaatgcacggttggatgcggtattcgccgcgcttgccgatgcacgtacccgccac
ggcgccgatgcattgggcagctacatcatctcgatggcgcataaccgcgccgacgtgttg
actgtgctggcactggcgcggcgtggcggcctggtcgacgacgccggcgctgtgccgctg
gatatcgtgccgctgttcgaaaccgtggacgatctgcgcggcggtaccggcaccgtgcag
gacctgctggccgacccggtctatcgccagcatctggccgcacgcggcgatacccagatg
gtgatgctgggctattcggacagcggcaaggacggcggcatcgccgcctcgcgctggggc
ctgcaacgcgcgcaggtcgagctgctggaagcggccgccgagttgggcgtgcggctgacc
ttcttccacggccgaggcggctcgatcgcgcgcggcggcggcaagaccagccgcgcgctg
gatgccgcaccgcgcggcagcgtggatgggcgcctgcgcgttaccgagcagggcgaggtg
atccaccgcaaatatggcatccgcgcattggcgttgcgctcgctggagcagatgaccggc
gcggtgctgctctcgagcctgcgcccgcgtgcgcccgagccgcgcgaggcgcgttggcgc
ccggtgatggatctggtggccgaacgcagcacggtcgcgtatcgcgccttcgtcggcgcg
ccggagttcatgcagtacttccgcctggccacgccgatcgatgtgatcgaacgcatgacg
ctgggttcgcgcccgtcgcggcggctgggccaggacgcggcgctgtccaacctgcgtgcg
attccgtgggtgtttgcgtggagccaggcgcgtgcggtgattcccggctggtacggcgtg
ggcagcggcctgcaggcggcggtggatgccgggcatgaagagaccttgcgcgaaatggcg
caggactggccgttcttccgcacctttctggacgacatcgccatggtgttgtccaagggc
gatctgaacatcgccgagttgttctcgcgcttgtccggcgacctgcacacgcggtttttc
ccgctgattcgcgacgaactggcattgaccaagggctgggtgaaggcgctgctgcaacaa
cagtcgctgttgcagcacgacccgcggctggcgttgtcgatccgcctgcgcaatccctac
atcgacccgatcagcgtgctgcaggtggatctgctgcaacgctggcgcgccaccgatggc
gaagacgaagcgctgctgcgcgcgctggtggcctgcgtcaatggcgtctcgcaaggcgtg
cagaacaccggctga

DBGET integrated database retrieval system