KEGG   Xanthomonas citri subsp. citri Aw12879: XCAW_03784Help
Entry
XCAW_03784        CDS       T02519                                 

Gene name
amyA
Definition
(GenBank) Glycosidase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
xci  Xanthomonas citri subsp. citri Aw12879
Pathway
xci00500  Starch and sucrose metabolism
xci01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xci00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    XCAW_03784 (amyA)
Enzymes [BR:xci01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     XCAW_03784 (amyA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase
Motif
Other DBs
NCBI-ProteinID: AGI09549
LinkDB All DBs
Position
4220282..4221709
Genome map
AA seq 475 aa AA seqDB search
MRNTPAHAPPSLIQCGVRLLLTALVLLVTTANAQADVILHAFNWPYATVEARAKQIADAG
YRKVLVAPAYRSEGSAWWARYQPQDIRLIDNPLGDTAAFKKMVQALASNGVETYADIVFN
HMANEAATRSDLNYPGGAVLSQYAANPGRYDSLRLFGTLQSNFLSASDFGPAQCISNYND
AYQVRNYRICGGGSDPGLPDLLGNDWVVQQQRAYLQALKSMGVTGFRVDAAKHMTFDHLN
RVFDAGIRSGVYVFGEVITGGGTGNGDYDQFLAPYLQSTPHAAYDFPLFNAVRNAFAIGA
SMQQLVDPAASGQALPGNRAVTFAVTHDIPNNAGFRYAILDPVDETLAYAYLIGRNGGMP
MLYTDNNESGDNRWVNAYLRDDLRRMIGFHNGVQGTDMQVLSSSSCHILFRRGSLGIVGI
NKCGNPVTTTVGMNNSVLYWNADYVDALGSGNVVRISSSSYTFTLPARGARMWRR
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaacacgcctgctcatgctccaccctcactgatacaatgcggtgtccgtctcttg
ctgactgcattggtcctgctggtgaccaccgccaacgcgcaggccgatgtcatcctgcac
gccttcaactggccgtatgccaccgtggaagcgcgcgccaagcagattgccgatgccggc
tatcgcaaggtattggtcgcccccgcgtaccgctccgaaggaagtgcctggtgggcgcgc
tatcaaccccaggacatccgcctgatcgacaatccgctcggcgacaccgctgcattcaag
aagatggtccaggcgctggccagcaacggcgtggaaacctatgccgacatcgtgttcaac
cacatggccaacgaagcggccacacgctcggacctcaattacccaggcggcgcggtcctg
tcgcagtacgcggcaaaccccggccgttacgattcgctgcgcttgttcggcacgctgcag
tcaaacttcctcagcgccagcgatttcggcccggcgcagtgcatcagcaactacaacgac
gcttaccaggtgcgcaattaccgtatctgcggcggcggcagcgatccaggcctgccggat
ttgctgggcaacgactgggtggtacagcagcagcgcgcctatctgcaggcgctcaagagc
atgggcgtgaccggcttccgggtggatgcggccaagcacatgacgttcgaccatctcaat
cgcgtcttcgatgccggcatccgatcgggtgtgtatgtcttcggcgaagtgatcaccggc
ggcggtacgggcaatggcgattacgaccagttcctggcgccgtacctgcaatccacgccg
catgcggcctacgactttccgctgttcaatgcggtgcgcaacgcgttcgccattggcgcc
agcatgcagcagctggtggatcccgccgcgtccggacaggcattgccgggcaatcgcgcc
gtgacctttgcagtgacccacgacattcccaacaacgccggattccgctatgcgattctc
gacccggtggatgaaacgctggcctacgcgtacctgatcggtcgcaacggcggcatgccg
atgctttataccgacaacaacgaaagcggcgacaatcgctgggtcaacgcttatctacgc
gacgatctgcgccgcatgatcggcttccataatggcgtgcagggcaccgacatgcaggtc
ttgtcgtccagctcctgccacatcctgttccgtcgcggcagcctgggcatcgtgggcatc
aacaagtgcggcaacccggtcaccaccacggtgggaatgaacaacagcgtgttgtactgg
aatgccgattacgtggatgccttgggctcgggcaacgtagtgcgcatttccagtagttcc
tacacctttacgctgccggcgcgcggggcgcgcatgtggcgccgctga

DBGET integrated database retrieval system