KEGG   Xanthomonas citri subsp. citri UI6: J158_00143
Entry
J158_00143        CDS       T03894                                 

Definition
(GenBank) glutamate synthase (NADPH) small subunit
  KO
K00266  glutamate synthase (NADPH) small chain [EC:1.4.1.13]
Organism
xcj  Xanthomonas citri subsp. citri UI6
Pathway
xcj00250  Alanine, aspartate and glutamate metabolism
xcj00910  Nitrogen metabolism
xcj01100  Metabolic pathways
xcj01110  Biosynthesis of secondary metabolites
xcj01120  Microbial metabolism in diverse environments
xcj01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:xcj00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    J158_00143
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    J158_00143
Enzymes [BR:xcj01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.13  glutamate synthase (NADPH)
     J158_00143
SSDB
Motif
Pfam: Fer4_20 Pyr_redox_2 Pyr_redox Pyr_redox_3 NAD_binding_8 2-Hacid_dh_C HI0933_like NAD_binding_7 FAD_binding_3 FMO-like AlaDh_PNT_C FAD_oxidored FAD_binding_2 DAO Thi4 GIDA Lycopene_cycl Amino_oxidase 3HCDH_N NAD_binding_9 zf-HIT Oxidored_nitro
Other DBs
NCBI-ProteinID: AJY84574
LinkDB
Position
complement(37522..39003)
AA seq 493 aa
MSRKQAFQFLDLPRTMPTRIPVELRTSGDWGELYGRFDKADAQYQAGRCLDCGNPYCSWK
CPVHNAIPQWLQLVQEDRIIEAAALCHSTNPLPEVCGRVCPQDRLCEGSCTLEEFGAVTI
GAVEKYIVDTAFKMGWRPDLGNVQASGHRVAVIGAGPAGLACADRLARAGIEAVVYDRYE
QIGGLLQFGIPSFKLDKSVIGKRREILEGMGVQFRLGVEVGRDVSIEQLLGEYDAVFLGT
GAYRYTDGGLPGQDLKNVLPALPFLVQNSRIVSGNDPHGRPIAGWEDQLALPDLTGKRVV
VLGGGDTGMDCVRSAIRLGAAKVTCAYRRDEASMPGSAREVANAREEGVRFLFNRQPLSI
ESGADDEAIGVTVVETKLGEPDASGRRNAVPVEGSESLLEADVVIIAFGFSPTLPDWLAS
QGVDAGSNGRIVAPSDGNGRLPYQTTNPRLFAGGDCVRGADLVVTAVAEGRDAAGSIVQL
LGVKAQVKEPAAA
NT seq 1482 nt   +upstreamnt  +downstreamnt
atgagccgcaaacaagccttccaattcctcgacctgccccggaccatgcccacgcgcatt
ccggtggaactgcgcacgtccggcgactggggcgagttgtacggcaggttcgacaaggcc
gacgcgcaataccaggccggccgttgcctggactgcggtaatccgtattgcagctggaaa
tgcccggtgcacaacgccatcccgcaatggctgcagctggtgcaggaagaccgcatcatc
gaggccgccgcgttgtgccattcgaccaacccgctgccggaagtgtgcgggcgggtgtgt
ccgcaggaccgcctgtgcgaaggcagctgcacgctggaagaattcggcgcggtcaccatc
ggcgcggtggagaaatacatcgtcgacaccgccttcaagatgggctggcgcccggacctg
ggcaacgtgcaggccagcggccaccgtgtggcggtgatcggcgccggcccggccggcctg
gcgtgtgcggaccgcctggcgcgcgccggtatcgaagcggtggtgtacgaccgctatgag
cagatcggcggcctgctgcagttcggcatccccagcttcaagctggacaaatcggtgatc
ggcaagcgccgcgagatcctcgaaggcatgggcgtgcagttccgcctgggcgtggaggtc
ggccgcgacgtcagcatcgagcagttgctgggcgaatacgacgcagtgttcttagggacc
ggcgcgtatcgctacaccgacggcggcctgcccgggcaggacctgaagaacgtgctgccg
gccctgccgttcctggtgcagaacagccgcatcgtcagcggcaacgacccgcacggccgg
ccgatcgctggctgggaagaccagctcgccctgcccgacctcaccggcaagcgcgtggtg
gtgctgggcggtggcgacaccggcatggactgcgtgcgcagcgccattcgtctgggcgca
gccaaggtcacctgcgcgtatcgccgcgacgaagccagcatgcccggctcggcacgcgag
gttgccaacgcacgcgaagaaggcgtgcgcttcctgttcaaccgccaaccgctgtcgatc
gaatccggcgccgacgacgaagccatcggcgtgaccgtagtggaaaccaagctgggcgaa
cccgacgccagcggccgccgcaatgcggtgccggtggaaggcagcgaatcgctgctggaa
gcggacgtggtgatcatcgccttcggcttctcgcctaccctgcccgactggttggcctcg
caaggcgtggacgccggcagcaatggccgcatcgtcgccccgtccgacggcaacggccgc
ctgccctaccagaccaccaacccgcgcctgttcgccggcggcgactgcgtgcgcggcgcc
gatctggtggtgaccgcagtagccgaaggccgcgatgcggcgggaagcatcgtgcagctg
ctcggggtcaaagcgcaggtcaaggagccggctgcggcgtag

DBGET integrated database retrieval system