KEGG   Xanthomonas citri subsp. citri UI6: J158_00496
Entry
J158_00496        CDS       T03894                                 

Definition
(GenBank) glucose-inhibited division protein A
  KO
K03495  tRNA uridine 5-carboxymethylaminomethyl modification enzyme
Organism
xcj  Xanthomonas citri subsp. citri UI6
Brite
KEGG Orthology (KO) [BR:xcj00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:xcj03016]
    J158_00496
   03036 Chromosome and associated proteins [BR:xcj03036]
    J158_00496
Transfer RNA biogenesis [BR:xcj03016]
 Eukaryotic type
  tRNA modification factors
   Other tRNA modification factors
    J158_00496
 Prokaryotic type
    J158_00496
Chromosome and associated proteins [BR:xcj03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    J158_00496
SSDB
Motif
Pfam: GIDA GIDA_assoc FAD_oxidored Pyr_redox_2 FAD_binding_2 HI0933_like Thi4 AlaDh_PNT_C Pyr_redox_3
Other DBs
NCBI-ProteinID: AJY84927
LinkDB
Position
complement(447780..449684)
AA seq 634 aa
MSDSFYRYDVIVIGGGHAGTEAALASARAGARTLLLTHNIETVGAMSCNPAIGGIGKGHL
VKEIDALGGAMARAADLAGIQWRTLNASKGPAVRATRCQADRNLYRTAIRCIVEAQPNLT
VFQAAVDDLIIHHGASEADSVRGVITQTGLRFQAPSVVLTAGTFLAGKIHVGQTQYAAGR
MGDPPATTLAARLRERPFAIDRLKTGTPPRIDGRTLDYGVMAEQPGDDPLPVMSFMGQVS
DHPRQVSCWITQTTEQTHEIIRNALHRSPLYSGQIEGIGPRYCPSIEDKVVRFAEKTSHQ
IFVEPEGLEVAEIYPNGISTSLPFDVQLALVRSIHGFANAHITRPGYAIEYDFFDPRGLK
ASLETKAVGGLFFAGQINGTTGYEEAAAQGLLAGLNAARHVQGLPAWSPRRDEAYLGVLV
DDLITHGTTEPYRMFTSRAEYRLQLREDNADARLTGVGRAMGLVDDARWARFAAKQEAVQ
RETARLSALWATPGNALGREVADALGVTVSRETNVLDLIKRPELTYATLMRVPTLGPGVD
DAQVAEQVEISVKYAGYLDRQRDDIARQQRHETTPIPDGFDYASVRGLSIEVQQKLERVR
PQHIGQAQRIPGMTPAAISLLLVHLERARRSQVA
NT seq 1905 nt   +upstreamnt  +downstreamnt
atgtccgactccttttatcgctacgacgtcatcgtgatcggaggtggtcatgccggcacc
gaggccgcccttgcgtctgcacgcgcaggcgcgcgcaccttgctgctcacccacaacatc
gagacggtgggggcgatgagctgtaacccggccatcggcgggatcggcaagggccacctg
gtcaaggagatcgacgcactcggcggggcgatggcacgcgcagcggatctggccggcatc
cagtggcgcacgctcaacgcctccaaggggccggcagtgcgtgccacgcgctgccaggcc
gaccgcaacctgtaccgcactgcgatccgctgcatcgtcgaggcccagcccaacctgacc
gttttccaggcggccgtggacgatctgatcattcatcacggcgccagcgaagccgacagc
gtgcgtggggtcatcacccagaccggactgcgtttccaagcgccttcggtggtgctgacg
gccggcacgttcctggccggcaagatccatgtcggccaaacgcagtacgcggccgggcgc
atgggcgatccgccggccaccacgctggccgcgcgcctgcgcgagcgcccgttcgcgatc
gaccggctcaagaccggcaccccgccgcggatcgacgggcgcaccctcgattacggcgtg
atggccgagcagcccggcgacgacccattgccggtgatgtcgttcatgggccaggtcagc
gaccatccgcgccaggtcagctgctggatcacccagaccaccgagcaaacccacgagatc
attcgcaacgcgctgcatcgctcgccgctgtattcggggcagatcgaaggcatcggcccg
cgctactgcccgtcgatcgaagacaaggtggtgcgttttgccgagaagaccagccaccag
atcttcgtcgaacccgaaggcctggaagtggccgagatctatcccaacggtatttccacc
tcgctgccgttcgatgtgcagctggcgctggtgcgctcgatccacggctttgcgaacgcg
cacatcacccgccccggctacgccatcgagtacgacttcttcgacccgcgcgggctcaag
gcctcgctggagaccaaggcggtgggcgggctgttcttcgccgggcagatcaacgggacc
accggttacgaagaggcggccgcccagggtctgctcgccgggctcaacgcagcgcgccac
gtgcaggggctgccggcgtggtcgccgcgccgcgatgaggcctacctgggcgtgctggtg
gacgatctcattacccacggcaccaccgagccgtaccgcatgttcaccagccgcgccgaa
taccgattgcagctgcgcgaggacaatgccgatgcgcgcctgaccggcgtcgggcgtgcg
atgggcctggtggacgacgcgcgctgggcgcgctttgcggccaagcaggaggccgtgcaa
cgcgaaacggcgcggctgtctgcactgtgggccacaccgggcaatgcgctgggccgcgag
gtggccgacgcgctgggcgtgacggtcagccgcgaaaccaacgtgctggatctgatcaag
cgcccggaactcacctacgccaccttgatgcgggtgccgaccctgggcccgggcgtggac
gatgcgcaggtggccgagcaggtcgagatcagcgtcaagtacgccggttatctggatcgc
cagcgcgacgatatcgcgcgtcagcaacgtcacgaaaccacgccgatcccggacggtttc
gattacgccagcgtgcgcggcctgtcgatcgaagtgcagcagaaacttgaacgcgtgcgc
ccccagcacatcggtcaggcacaacggattcccggcatgaccccggcggcgatctcgctg
ctgctggtgcatctggagcgcgcgcgacgcagccaagtggcgtga

DBGET integrated database retrieval system