KEGG   Xanthomonas citri subsp. citri UI6: J158_01029Help
Entry
J158_01029        CDS       T03894                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
xcj  Xanthomonas citri subsp. citri UI6
Brite
KEGG Orthology (KO) [BR:xcj00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    J158_01029
Enzymes [BR:xcj01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     J158_01029
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 FAD_oxidored HI0933_like DAO FAD_binding_3 AlaDh_PNT_C NAD_binding_7 Glutaredoxin Thioredoxin_4 FMO-like K_oxygenase Thi4 NAD_binding_8 Spermine_synth
Motif
Other DBs
NCBI-ProteinID: AJY85454
LinkDB All DBs
Position
complement(1066929..1068521)
Genome map
AA seq 530 aa AA seqDB search
MLDANLKTQLTAYLERVTRPIQINASIDDSAGSREMLDLLEELVLLSDKISLDIHRDDNQ
RKPSFALTTPGQDISLRFAGLPMGHEFTSLVLALLQVGGHPSKAAAELIEQVQHLDGDYQ
FETYFSLSCQNCPDVVQALNLAAVLNPRIKHVAIDGAWFQEEVEARQIMSVPTVYLNGEL
FDQGRMTLEQIVAKLDTNAAKRDAAKIAAKEAFDVLVVGGGPAGSAAAVYAARKGIRTGV
AAERFGGQVLDTMSIENFISVPETEGPKMAAALEQHVRQYDVDIMNLQRAEQLIPAGADG
LIEIKLANGASLKSKTVILSTGARWRQMNVPGEDQYKNKGVAYCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGIVAHVTLVEFDDKLRADEVLQRKLRSLHNVRIITSAQTTEVLGDG
QKVTGLVYKDRTGGDIQHIELEGVFVQIGLLPNTEFLRGTVALSPRGEVIVDDRGQTDVP
GVFAAGDATTVPYKQIVIAMGEGSKAALSAFDHLIRTSAPATADSVAQAA
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgttggatgccaatctcaagacccagctgaccgcctacctggaacgggtgacgcggccg
attcaaatcaacgcctccatcgacgacagtgccggctcgcgcgaaatgctcgacctgctg
gaagagttggtgctgttgtcggacaagatcagcctggacatccaccgcgacgacaaccag
cgcaagccctcgttcgcgctgaccacgcccggccaggacatctcgctgcgctttgccggg
ctgccgatgggccatgagttcacctcactggtgctggcgctgctgcaggtgggcggccac
ccgtccaaggccgccgccgagctgatcgagcaggtgcagcacctggatggcgattaccag
ttcgaaacctatttctcgctgtcgtgccagaactgcccggacgtggtgcaggcgctgaac
ctggcggccgtgctcaacccgcgcatcaagcacgtggccatcgatggcgcctggttccag
gaagaagtagaggcccgccagatcatgtcggtgcccaccgtgtacttgaacggcgagctg
ttcgaccagggccgcatgacgctggagcagatcgtcgccaagctggataccaatgccgcc
aagcgcgacgctgcgaaaatcgctgcaaaagaagcgttcgacgtgctggtggtgggcggt
ggcccggccggttcggcagcagcggtgtatgccgcacgcaagggcatccgcaccggcgtg
gccgccgagcgttttggtgggcaggtgctggacaccatgtcgatcgagaacttcatttcc
gtgccggaaaccgaaggcccgaagatggccgccgcgctcgagcaacacgtgcgccagtac
gacgtggacatcatgaatctgcagcgtgccgagcagctgatcccggccggtgccgatggc
ctgatcgaaatcaagctggccaatggcgcctcgctcaagagcaagaccgtgatcctgtcc
accggtgcgcgctggaggcagatgaacgtgcctggcgaagatcagtacaagaacaagggc
gtggcgtattgcccgcactgcgatggcccgctgttcaagggcaagcgcgtggcggtgatc
ggcggcggcaactcgggcgtggaagcggcgatcgatctggccggcatcgtggcgcatgtc
acgctggtggaattcgacgacaagctgcgcgccgacgaagtgctccaacgcaagctgcgc
agcctgcacaacgtacgcatcatcaccagcgcgcagaccactgaagtactcggcgacgga
cagaaggtcaccggtctggtctacaaggaccgcaccggcggcgatatccagcacatcgag
ctggaaggcgtgttcgtgcagatcggcctgctccccaacaccgagttcctgcgcggcacg
gtggcgctgtcgccgcgcggcgaagtcatcgtcgacgaccgtggccagaccgatgtaccc
ggcgtgttcgccgctggcgacgccaccacggtgccgtacaagcagatcgtgatcgcaatg
ggcgaaggttccaaggcggcgctgagtgcattcgaccacctgatccgcaccagcgcaccg
gccactgccgacagtgtggcccaggccgcataa

DBGET integrated database retrieval system