KEGG   Xanthomonas citri subsp. citri UI6: J158_01316
Entry
J158_01316        CDS       T03894                                 

Definition
(GenBank) Thioredoxin reductase
  KO
K00384  thioredoxin reductase (NADPH) [EC:1.8.1.9]
Organism
xcj  Xanthomonas citri subsp. citri UI6
Pathway
xcj00450  Selenocompound metabolism
Brite
KEGG Orthology (KO) [BR:xcj00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    J158_01316
Enzymes [BR:xcj01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.9  thioredoxin-disulfide reductase
     J158_01316
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 cNMP_binding FAD_binding_3 Pyr_redox NAD_binding_8 DAO K_oxygenase HI0933_like Thi4 FAD_oxidored FAD_binding_2 Lycopene_cycl NAD_binding_9 GIDA MliC 3HCDH_N
Other DBs
NCBI-ProteinID: AJY85724
LinkDB
Position
1347287..1348996
AA seq 569 aa
MSLDQTRHHQMFPELDAGQLSITRRFASGPAQRFGAGDTVFEVGDAHAPVWVVLEGAIEV
VRRDGLGNEKPITRHTPGQFTGEVSQLAGRASLAAGRAGPDGCLALPFDTAHLRALMISS
AEVGEVVMRALILRRVGLIEGDASGSVLIGEPDDPHLTRLQGFLTRNGYPNTVMDVSDDE
GRALVQRLGIQEHDLPVMVCPSGRVLRQPSDAEAAHCLGMTPDIDPDKRYDVAIVGAGPA
GLATAVYAASEGLSVLVLDQRAIGGQAGASARIENYLGFPTGISGQALAGRAYNQALKFG
AELAIPIEAAMLECGRDDGALKLDLADGKQLLASTVVIASGARYRRPEIEGLDRFEGHGV
SYWASPVEARLCEGGVVALVGGGNSAGQAVAFLAPRVKELHLIIRGDGLESSMSQYLIER
IAALPNVQLHTGTEVAALEGDPERGLQAAVLRTRKDGATARVELRHLFLFVGADPNTGWL
QDCVDTDKRGFVMTGTARGDGVPACLPLETNRPGVFAIGDVRAGSVKRVAAAVGEGAAVV
AQIHQYLAHQANPVPVSELASATQESTSA
NT seq 1710 nt   +upstreamnt  +downstreamnt
atgtctttggaccagacccgccaccatcagatgtttcccgagctggacgcgggccagttg
tcgatcacccggcgcttcgccagcgggccggcgcaacggttcggcgcgggcgataccgta
tttgaggtcggcgatgcccatgcgccggtgtgggtggtgctggagggcgccatcgaagtg
gtgcgccgcgatggattgggcaacgaaaagccgatcacccggcacacgcccggccagttc
accggcgaggtgagtcagctggccgggcgcgcgtcgctggcggctggacgtgccgggccg
gacggctgcctggcgctgccgttcgataccgcgcatctgcgcgcgctgatgatcagttcg
gccgaagtgggcgaagtggtgatgcgtgcattgatcctgcgccgcgtcgggctgatcgag
ggcgatgcgtcgggttcggtgctgatcggcgagccggacgacccgcatctgacccggttg
cagggctttttgacccgtaacggctaccccaacacggtgatggatgtctccgacgacgaa
ggccgcgcgttggtgcagcgcctgggtatccaggagcacgatctaccggtgatggtatgc
ccgagcgggcgcgtgctgcgccagcccagcgatgccgaagccgcgcattgcctgggcatg
acgccggacatcgacccggacaaacgctacgacgtggcgatcgtgggcgccggccccgcc
ggcctggcgacggcggtgtatgccgcatccgaaggcttgtcggtgctggtgctggaccag
cgcgccatcggcgggcaggccggtgcctcggcgcgtatcgaaaattatctcggctttccc
accggcatttccgggcaggcgctggccgggcgcgcgtacaaccaggcgctgaaattcggc
gcggaactggcgattccgatcgaagcggccatgctggaatgcggccgcgacgatggcgcg
ctgaagctggatcttgccgatggcaaacagttgctggccagcacggtggtgatcgcgtcg
ggtgcgcgttaccggcgcccggagatcgagggcctggatcgcttcgaaggccacggtgtg
tcctactgggcctcgccggtggaagcgcgcctgtgcgaaggcggcgtggtggcgctggtg
ggcggcggcaattctgcagggcaggcggtggcgttcctggcgccgcgggtcaaggagctg
cacctgatcattcgcggcgacgggttggagagctcgatgtcgcaatatctcatcgaacgt
atcgccgcgttgccgaacgtgcagctgcacaccggcaccgaagtggccgcgctggaaggc
gaccccgagcgcggcttgcaggccgcggtgttgcgcacccgcaaggacggtgcaaccgcg
cgcgtggagttgcggcacctgttcctgttcgtcggcgcagaccccaacaccggttggctg
caggactgcgtggacaccgacaagcgcggctttgtcatgaccggcaccgcgcgtggcgac
ggcgtaccggcgtgcctgccgctggaaaccaatcgccctggcgtgttcgccatcggcgat
gtgcgtgcgggctcggtcaagcgcgtggccgctgcagtgggcgagggcgccgccgtggtc
gcgcagatccatcagtacctcgcccatcaggccaacccagtgccggtctccgaacttgcc
agcgccacccaggagtccaccagcgcatga

DBGET integrated database retrieval system