KEGG   Xanthomonas citri subsp. citri UI6: J158_01681
Entry
J158_01681        CDS       T03894                                 

Definition
(GenBank) dihydrolipoamide dehydrogenase
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
xcj  Xanthomonas citri subsp. citri UI6
Pathway
xcj00010  Glycolysis / Gluconeogenesis
xcj00020  Citrate cycle (TCA cycle)
xcj00260  Glycine, serine and threonine metabolism
xcj00280  Valine, leucine and isoleucine degradation
xcj00310  Lysine degradation
xcj00380  Tryptophan metabolism
xcj00620  Pyruvate metabolism
xcj00630  Glyoxylate and dicarboxylate metabolism
xcj00640  Propanoate metabolism
xcj01100  Metabolic pathways
xcj01110  Biosynthesis of secondary metabolites
xcj01120  Microbial metabolism in diverse environments
xcj01200  Carbon metabolism
Module
xcj_M00009  Citrate cycle (TCA cycle, Krebs cycle)
xcj_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
xcj_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:xcj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    J158_01681
   00020 Citrate cycle (TCA cycle)
    J158_01681
   00620 Pyruvate metabolism
    J158_01681
   00630 Glyoxylate and dicarboxylate metabolism
    J158_01681
   00640 Propanoate metabolism
    J158_01681
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    J158_01681
   00280 Valine, leucine and isoleucine degradation
    J158_01681
   00310 Lysine degradation
    J158_01681
   00380 Tryptophan metabolism
    J158_01681
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:xcj04147]
    J158_01681
Enzymes [BR:xcj01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     J158_01681
Exosome [BR:xcj04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   J158_01681
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox GIDA AlaDh_PNT_C 3HCDH_N HI0933_like FAD_binding_2 FAD_binding_3 DAO FAD_oxidored 2-Hacid_dh_C Lycopene_cycl NAD_binding_8 Thi4 UDPG_MGDP_dh_N Pyr_redox_3 Nairovirus_M
Other DBs
NCBI-ProteinID: AJY86084
LinkDB
Position
complement(1770576..1772012)
AA seq 478 aa
MSEQFDVVVIGAGPAGYHAAIRAAQLGMKVACIDAALGKDGKPALGGTCLRVGCIPSKAL
LDSSRQFWNMGHLFGDHGISFNDAKMDVPTMIGRKDKIVKQFTGGIAMLFKANKITPYYG
FGQLQPGNIVKVTQHEGGEIELKGTNVILAAGSESIELPFAKFDGDTIVDNVGGLDFTAV
PKRLAVIGAGVIGLELGSVWKRLGAEVTILEALPDFLALADAEVAKTALKEFKKQGLDIK
LGAKVGKTEITGSDDAKQVVLSYTDATGEQTLTVDKLLVAVGRKAATKNLLADGTGVKVT
DRGQIEVDGHCHTGVDGVWAIGDCVRGPMLAHKGFEEGIAVAELIAGLPGHVNFDTIPWV
IYTEPEIAWVGKTEQQLKAEGVAYKAGSFPFAAIGRAVAMGEPAGFVKVIADAETDRVLG
MHLVGVGVSELVHEGVLTMEFSGSADDLARICHAHPTLSEAIHDAAMAVSKRAIHKAN
NT seq 1437 nt   +upstreamnt  +downstreamnt
atgagcgaacaattcgacgtcgtcgtcatcggtgccggtccggccggttatcacgccgcc
atccgtgcggcgcagctgggcatgaaggtcgcctgcatcgacgcggccctgggcaaggac
ggcaagccggcactgggcggtacctgcctgcgcgtgggctgcattccgtccaaggcgctg
ctggattcctcgcgccagttctggaacatgggccacctgttcggcgaccacggaatcagc
ttcaacgacgccaagatggacgtgcccaccatgatcggccgcaaggacaagatcgtgaag
cagttcaccggcggcatcgcgatgctgttcaaggccaacaagatcaccccgtactacggc
ttcggccagttgcagccgggcaacatcgtcaaggtgacccagcatgaaggcggcgagatc
gagctcaagggcaccaacgtgatcctggcggccggttcggaatcgatcgaactgccgttc
gccaagttcgacggcgacaccatcgtcgacaacgtcggcggcctggatttcaccgccgtt
cccaagcgtctggccgtcatcggtgccggcgtgatcggcctggagctgggcagcgtgtgg
aagcgcctgggcgccgaggtgaccatcctcgaagcgctgccggacttcctggccctggcc
gatgccgaagtggccaagaccgccttgaaggaattcaagaagcagggtctggacatcaag
ctgggcgccaaggtcggcaagaccgagatcaccggcagcgacgacgccaagcaggtggtg
ctcagctacaccgacgcgaccggcgagcagaccctgaccgtggacaagctgctggtggcc
gtgggccgcaaggccgccaccaagaacctgctggccgacggcacgggcgtcaaggtcacc
gaccgcggccagatcgaggtcgacgggcattgccacaccggcgtggatggcgtgtgggcg
atcggcgactgcgtgcgcggcccgatgctggcgcacaagggcttcgaggaaggcatcgcg
gtggccgaattgatcgccggcctgccgggtcacgtcaatttcgacaccattccgtgggtc
atctacaccgagccggaaatcgcctgggtcggcaagaccgagcagcagctcaaggccgag
ggcgtcgcctacaaggccggcagcttcccgttcgcagcgatcggtcgcgcggtggcgatg
ggcgagccggccggcttcgtcaaagtgatcgccgatgccgaaaccgaccgcgtgctgggt
atgcacctggtgggcgtgggcgtttccgagctggtgcacgaaggcgtgctgaccatggag
ttcagcggctcggccgacgacctggcccgcatctgccacgcgcacccgacgctgtccgaa
gcgatccacgatgccgcgatggcggtgagcaagcgcgcgattcataaggccaattaa

DBGET integrated database retrieval system