KEGG   Xanthomonas citri subsp. citri UI6: J158_02151
Entry
J158_02151        CDS       T03894                                 

Definition
(GenBank) thioredoxin-disulfide reductase
  KO
K00384  thioredoxin reductase (NADPH) [EC:1.8.1.9]
Organism
xcj  Xanthomonas citri subsp. citri UI6
Pathway
xcj00450  Selenocompound metabolism
Brite
KEGG Orthology (KO) [BR:xcj00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    J158_02151
Enzymes [BR:xcj01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.9  thioredoxin-disulfide reductase
     J158_02151
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox FAD_oxidored Thi4 FAD_binding_2 GIDA HI0933_like FMO-like NAD_binding_8 Shikimate_DH Trp_halogenase NAD_binding_7
Other DBs
NCBI-ProteinID: AJY86547
LinkDB
Position
complement(2329876..2330844)
AA seq 322 aa
MSASSASPAKHSRLLILGSGPAGWTAAVYAARANLKPVVITGLQQGGQLMTTTEVDNWPG
DPHGLMGPDLMSRMQAHAERFETEVIFDHIHTADLSQRPFRLIGDGAEYTCDALIIATGA
TAKYLGIPTEEAFKGRGVSACATCDGFFYKDQDVVVVGGGNTAVEEALYLSNIARKVYLV
HRRDTLRAEKIMQDKLFAKVAAGKIETVWHHAIDEVLGNDAGVTGVRVKSTIDGSTRDID
AHGFFVAIGHHPNTQLFDGQLAMNNGYLEIRSGLNGAATETSVAGVFAAGDVADQHYRQA
ITSAGFGCMAALDAERFLDKSA
NT seq 969 nt   +upstreamnt  +downstreamnt
atgagcgcctcttctgccagccccgccaagcattcccgcctgctgatcctgggctccggc
ccggccggctggaccgccgcggtctatgccgcccgcgccaacctcaagccggtggtcatc
accgggttgcaacaaggcggccagctgatgaccacgaccgaagtggacaactggccgggc
gacccccatggcctgatgggcccggacctgatgagccgcatgcaggcgcatgccgagcgc
ttcgagaccgaggtcatcttcgaccatatccacacggcagacctgtcgcaacgcccgttc
cggctgatcggcgacggtgccgagtacacctgcgacgcactgatcatcgccaccggcgcc
accgccaagtacctgggcatccccaccgaagaagccttcaagggccgcggcgtctccgcc
tgcgccacctgcgacggcttcttctacaaggaccaggatgtggtggtggtcggcggcggc
aacaccgcggtcgaagaggcgctgtacctgtccaacatcgcccgcaaggtctacctggta
catcgccgcgacaccctgcgtgcggaaaagatcatgcaggacaagctgttcgccaaggtg
gccgccggcaagatcgagaccgtctggcaccatgccatcgacgaagtattgggcaacgat
gccggggtcaccggcgtgagggtcaagtccaccatcgacggcagcacccgcgatatcgat
gcgcatggtttcttcgtggcgatcggccatcacccgaatacgcagttgttcgatggccag
ctggcaatgaacaacggctacctggagattcgttccggcctgaacggcgcggcgaccgaa
acctcggtggccggcgtgttcgccgccggcgacgtggccgaccagcattaccgtcaggcc
atcacctcggccggcttcggctgcatggccgcgctggatgccgaacgcttcctcgacaag
agcgcctga

DBGET integrated database retrieval system