KEGG   Xanthomonas citri subsp. citri UI6: J158_02409
Entry
J158_02409        CDS       T03894                                 

Definition
(GenBank) conjugative transfer region protein, TIGR03748 family
Organism
xcj  Xanthomonas citri subsp. citri UI6
SSDB
Other DBs
NCBI-ProteinID: AJY86792
LinkDB
Position
2626321..2626923
AA seq 200 aa
MPPPILPEPRSLGPTATLLALALLSGCTGAPLARHMAAPAASPASGVSTAPSFPAVPVVR
QGRYTLVEIAPIEGQRDLLMQTIDITLPTSDHATVQDGLQYLLRQSGYRLCPADADSAVL
YALPLPAAHVHLGPTTLLTALLAMSGNAWILDVDEAHREVCFRRAESVGAATATPSTHPP
DARMPPINAAPRHSPSEKLP
NT seq 603 nt   +upstreamnt  +downstreamnt
atgccgcctcctatcctgcccgagccccgcagccttggccctaccgccaccctcctcgct
ctggccttgctgagcggctgtaccggtgcgccgctggcgaggcacatggcggcgccggcc
gcatcgcccgcttccggcgtcagcaccgcaccgtcgttccccgcggtgcccgttgtccgg
cagggacgctacacgctcgtggagatcgcccccatcgagggacagcgcgacctgctgatg
cagacgatcgatataacgctacccacctcggaccacgccaccgtgcaagacgggctgcag
tatctccttcggcaatcgggctacaggctgtgcccggccgatgccgacagcgccgttctg
tacgcgttgcctctgcccgcggcccacgtgcacctgggaccgaccacgctcctcacggcc
cttctggcgatgtcgggcaacgcttggattctcgatgtagacgaagcccatcgagaggtc
tgcttccgccgcgccgagtcggtcggcgctgccaccgcgacgccaagcactcacccgccc
gatgcgcggatgccgccgatcaacgctgcgccccgccattcgccctcggagaagctgcca
tga

DBGET integrated database retrieval system