KEGG   Xanthomonas citri subsp. citri UI6: J158_02715
Entry
J158_02715        CDS       T03894                                 

Definition
(GenBank) putative NAD(FAD)-dependent dehydrogenase
  KO
K22549  D-hydroxyproline dehydrogenase subunit alpha [EC:1.5.99.-]
Organism
xcj  Xanthomonas citri subsp. citri UI6
Pathway
xcj00330  Arginine and proline metabolism
xcj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xcj00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    J158_02715
Enzymes [BR:xcj01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.99  With unknown physiological acceptors
    1.5.99.-  
     J158_02715
SSDB
Motif
Pfam: Pyr_redox_2 NAD_binding_8 FAD_binding_3 FAD_oxidored HI0933_like GIDA FAD_binding_2 Thi4 NAD_binding_7 DAO AlaDh_PNT_C Pyr_redox SO_alpha_A3 NAD_binding_9 Lycopene_cycl Pyr_redox_3 XdhC_C Amino_oxidase Staph_opine_DH THF_DHG_CYH_C Oxidored_nitro
Other DBs
NCBI-ProteinID: AJY87093
LinkDB
Position
complement(2993512..2994825)
AA seq 437 aa
MAERVLHFDVLVIGAGPAGLAAARAAVSQGVRVGVVDMQPRTGGQVWRSDVHSGAPADAR
ALLQQVAGNASITVLTRTQILLAQPGWLLADGPTGTLQLHYAALVLATGARELLLPFPGW
TLPGVTGAGAAQALAKQGWPLAGKRVLVAGSGPLLLASAATLQRHGAHVLGIHEQTSPAA
LRQFALQLWRWPGKAAQAVALRLQLRAVAYRAGSMVIAAHGDTQLREVELAGPSGRTRLA
CDQLAVGYGLVPNTELAQLLGCQLQAYGAHQQVQVDALLRTSVTQIFAAGEVCGIGGRDC
ALIEGAMAGHMAADAPEAALRLQPRRHAARAFADLLQQQFALDPRIRTLAQADTLICRCE
DVPLAALDSFNDARDAKLVSRCGMGACQGRICGAALAELGRCPPDLSTDAGRRPPLFPVR
LAALADSFTSDSQGKHP
NT seq 1314 nt   +upstreamnt  +downstreamnt
atggctgagcgcgtgctgcatttcgatgtgttggtgatcggcgccggcccggccgggctg
gcggcggcgcgggcggcggtcagccaaggcgtgcgcgtgggcgtggtcgacatgcagcca
cgtaccggcggtcaggtgtggcgcagcgatgtgcactccggcgcgccggccgatgcgcgc
gcattgctgcagcaggtggcgggcaatgcatcgatcaccgtgctgacgcgcacgcagatt
ttgctggcgcaaccgggctggctcctggccgatggccccaccggcacattgcagctgcat
tacgccgcgttggtgctggccaccggtgcgcgcgaattgctgctgccattcccgggatgg
accctgcccggcgtcaccggtgccggcgcggcgcaggcgctggccaagcagggctggccg
ctggctggcaagcgcgtgctggtggccggcagtggcccgttgttgctggccagtgcagcc
acgttgcaacggcatggcgcgcacgtgctcggcattcacgaacagacctcgccggccgcc
ttgcgccagttcgcactgcagctgtggcgctggccgggcaaggccgcgcaggcggtggcg
ctgcgcctgcagctgcgtgcagtggcatatcgcgccggcagcatggtgattgccgcgcac
ggcgacacgcagttgcgcgaagtggaactcgccgggcccagcggccgcacgcgtcttgcc
tgcgatcaactggcggtgggctatggcttggtgcccaataccgagcttgcgcaattgctg
ggttgccagctgcaagcgtacggcgcgcaccagcaggtgcaggtggatgcgctgttgcgt
accagcgtcacccagatctttgccgccggcgaagtctgcggcatcggcgggcgcgactgc
gcattgattgaaggtgcgatggccggacatatggcggccgatgcaccggaggcggcgctg
cgcctgcagccacggcgtcacgccgcgcgtgcgtttgccgatctgctgcagcagcaattc
gcgcttgatccgcgcatccgcacgctggcgcaggcggacacgttgatctgccgctgcgaa
gacgtaccgctggccgccctggacagcttcaacgatgcacgcgacgccaagctcgtctcg
cgctgcggcatgggcgcctgccagggccgcatctgcggtgcggcgctggccgaactgggg
cgttgcccgcccgatctttccaccgacgccggccgccggccgccgttgttcccggtccgc
ctcgcggcgctggccgactcgttcacttccgactcgcaagggaaacacccatga

DBGET integrated database retrieval system