KEGG   Xanthomonas citri subsp. citri UI6: J158_02919
Entry
J158_02919        CDS       T03894                                 

Definition
(GenBank) NADPH-glutathione reductase
  KO
K00383  glutathione reductase (NADPH) [EC:1.8.1.7]
Organism
xcj  Xanthomonas citri subsp. citri UI6
Pathway
xcj00480  Glutathione metabolism
xcj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xcj00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    J158_02919
Enzymes [BR:xcj01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.7  glutathione-disulfide reductase
     J158_02919
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox Pyr_redox_3 FAD_oxidored GIDA FAD_binding_2 DAO Thi4 NAD_binding_8 HI0933_like K_oxygenase 3HCDH_N
Other DBs
NCBI-ProteinID: AJY87290
LinkDB
Position
complement(3209492..3210862)
AA seq 456 aa
MSARYDYDVVILGGGSGGLAAGFRAAKHGARVAIMEPDELGGTCVNLGCVPKKAMWLAAD
LAGKIELASALGFDVPRPTLVWQELVTHRQGYIANIHASYRRRLNEDGVVLIPQRGVLQD
RHTVMGSDGVPVTAGHIVIATGAHALRPDVEGAEHGEVSDDFFNLCHAPEQVAIIGGGYI
AVEIAGLLQALGSRVHLFVQGERLLERFDAELTLQLADNLRHLGVRLHFGFTTTALERDM
HGALRVHGHSVHPREQGNDVFDKVFFAVGRRANTAGLGLDTVGVALGDKGEVVVDDRQTT
NVPNIHAIGDVGGKVGLTPVAIAAGRKLMDRLFGHQPDARMDYENVPSVVFSHPPLGNVG
LTEEQARARYNGAVRVYRSNFRPMLHALADAPQRSLFKLVCVGEEERVVGVHLLGESADE
MLQGFAVAVKMGATKRDFDETVAIHPTSSEEIVLMH
NT seq 1371 nt   +upstreamnt  +downstreamnt
atgagtgcgcgttacgactacgatgtggtgattctgggcggcgggtccggcggcctcgcg
gcgggatttcgcgcggcaaaacatggcgcgcgcgtggcgatcatggagcccgacgaattg
ggcggcacctgcgtcaatctcggttgcgtgccgaagaaggcgatgtggctggccgccgat
ctggccggcaagatcgagttggccagcgccttgggattcgatgtgccgcgcccgacgttg
gtctggcaggagctggtcacgcatcggcaggggtacatcgccaacatccacgccagctat
cgacgccgcctcaacgaagatggcgtggtcttgatcccgcagcgcggcgtattgcaggac
cgccataccgtcatgggcagcgacggcgtgccggtcaccgccgggcacatcgtgatcgcc
actggcgcgcacgcgttacgcccggacgtggagggcgcagagcatggcgaggtctccgac
gatttcttcaatctctgccatgcgcccgagcaggtcgcgattatcggcggcggctatatc
gcggtggaaatcgccgggctgctgcaggccttagggagccgcgtgcatctattcgtgcag
ggcgagcgcttgctggaacgcttcgatgcggaactgaccttgcagttggccgacaacctg
cgccatctgggcgtgcggctgcacttcggtttcaccaccaccgcattggagcgcgatatg
cacggtgcgctgcgcgtgcatgggcattccgtacatccgcgcgagcagggcaacgacgtc
ttcgacaaggtgtttttcgcggtgggccgccgcgccaataccgcagggctgggtctggac
accgtgggtgttgcgcttggcgacaagggcgaagtggtggtggacgacaggcagaccacc
aacgtgccgaatattcacgcaatcggcgatgtgggcggcaaggtcggactgacgccggtg
gcgattgcggcggggcgcaagctgatggaccgcctgttcggtcaccaaccggatgcgcgc
atggattacgaaaacgtgcccagcgtggtgttttcgcacccgccgcttggcaacgtcggg
ctcaccgaagaacaggcacgtgcgcgctacaacggggcggtgcgcgtgtaccgcagcaat
ttccgcccgatgctgcacgcactggcggacgcgccgcagcgcagcctgttcaagctggtg
tgcgtgggcgaagaagaacgtgtggtcggcgtgcatctgctgggtgagagcgccgacgaa
atgctgcaaggctttgcggtggcggtgaagatgggcgcgaccaagcgcgacttcgacgaa
accgtggcgattcatcccacctcgtctgaagagattgtgttgatgcactga

DBGET integrated database retrieval system