KEGG   Xanthomonas citri pv. citri MN12: J164_00595Help
Entry
J164_00595        CDS       T03735                                 

Definition
(GenBank) anthranilate synthase, component I
  KO
K01657  anthranilate synthase component I [EC:4.1.3.27]
Organism
xcm  Xanthomonas citri pv. citri MN12
Pathway
xcm00400  Phenylalanine, tyrosine and tryptophan biosynthesis
xcm01100  Metabolic pathways
xcm01110  Biosynthesis of secondary metabolites
xcm01130  Biosynthesis of antibiotics
xcm01230  Biosynthesis of amino acids
xcm02024  Quorum sensing
Module
xcm_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:xcm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    J164_00595
  09110 Biosynthesis of other secondary metabolites
   00405 Phenazine biosynthesis
    J164_00595
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    J164_00595
Enzymes [BR:xcm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     J164_00595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Chorismate_bind Anth_synt_I_N
Motif
Other DBs
NCBI-ProteinID: AJY93920
UniProt: A0A0U5BZK1
LinkDB All DBs
Position
566311..567786
Genome map
AA seq 491 aa AA seqDB search
MITAEQFQRQAAEGHTRIPVVREVLSDLDTPLSVYLKLADGAYTYLFESVEGGERFGRYS
IIGLPARRVYSFRGHTLEVSEHGEVVETREVADPLAEVDALRAEHSVPQLDGLPGFTGGL
VGWFGFECIQYIEPRLGSGDKPDELGTPDILLMLSEELAVFDNLKGRLYLIVHADPRQPQ
AYVRANRRLDELAHRLRQGGAGYPQAQISDAIDEADFHSSFTREEYHAVVRKAQEYVRAG
DIFQVVPSQRLRVPFRARPVDVYRALRALNPSPYMYFLDVGGTQVVGSSPEILARLRDGV
VTVRPIAGTRPRGATPELDKALEAELLADPKERAEHVMLIDLGRNDVGRVAEPGTVKVGE
QFVIERYSHVMHIVSEVTGTLKAGLNYSDVLRATFPAGTVSGAPKIRALEIIRELEPVKR
NVYSGAVGYIGWHGDADTAIAIRTAVIQDGYLYVQAGGGVVYDSDPDLEWQETMNKGRAL
FRAVAQAAKGL
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
ttgatcactgcagagcagttccagcgccaggccgctgaaggtcacacccgtattcccgtt
gtccgcgaagtgttgtccgacctggacacgccgctctcggtctacctgaagctcgccgac
ggcgcctatacctatctgttcgaatcggtcgaaggcggggagcgcttcgggcgctactcc
atcatcggcctgccggcgcggcgcgtgtacagctttcggggccacacgctggaggtcagc
gaacacggcgaagtcgtcgagacccgtgaggtcgccgacccgctggccgaagtcgatgcg
ttgcgggccgaacattcggtgccgcagctggatgggctgcccggcttcaccggcgggctg
gtcggctggttcggtttcgagtgcatccaatacatcgagccgcgcctggggagtggcgac
aagcccgacgaactcggcacgccggacatcctgctgatgctctccgaagagctggcggtg
ttcgacaatctcaagggccgtctgtacctgatcgtgcatgccgacccgcggcagccgcaa
gcctatgtgcgcgccaatcggcgcctggacgagctggcgcatcgcctgcgtcagggcggc
gccggttacccgcaggcgcagatttccgatgcgatcgacgaagcggacttccattcctct
tttacccgcgaggaatatcacgccgtggtgcgcaaggcgcaggaatacgtgcgtgccggc
gatatcttccaggtagtgccatcgcaacgcttgcgcgtgccgttccgcgcgcgcccggtg
gatgtgtatcgcgcgttgcgtgcactgaatccgtcgccgtacatgtattttctcgatgtc
ggcggtacccaggtggttggttcgtcgccagaaattctggcgcgcctgcgcgatggcgtg
gtcactgtgcgcccgatcgccggcacccgcccgcgcggcgccacgcccgaactggacaag
gcactggaagccgaactgctggccgacccgaaggaacgcgccgagcacgtgatgctgatc
gatctgggtcgcaacgatgtcggccgcgtggccgaaccgggcacggtcaaggtcggcgag
cagttcgtgatcgaacgctatagccatgtcatgcacatcgtcagcgaggtgaccggcacc
ctgaaagccggcctgaattatagcgacgtgctgcgcgccaccttcccggccggcactgtc
agcggcgcgccgaagatccgcgcgctggaaatcatccgcgagctggagccggtcaaacgc
aacgtgtattccggcgcggtcggctatatcggctggcatggcgatgccgataccgccatc
gccatccgcaccgccgtcatccaggacggttacctgtatgtgcaggccggcggcggcgtg
gtctacgactccgaccccgacctggagtggcaggaaaccatgaacaaggggcgtgcgctg
tttcgcgcagttgcccaggcggcgaagggcctgtga

DBGET integrated database retrieval system