KEGG   Xanthomonas citri pv. citri MN12: J164_00902Help
Entry
J164_00902        CDS       T03735                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
xcm  Xanthomonas citri pv. citri MN12
Pathway
xcm00473  D-Alanine metabolism
xcm00550  Peptidoglycan biosynthesis
xcm01100  Metabolic pathways
xcm01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:xcm00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    J164_00902
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    J164_00902
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    J164_00902
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:xcm01011]
    J164_00902
Enzymes [BR:xcm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     J164_00902
Peptidoglycan biosynthesis and degradation proteins [BR:xcm01011]
 Precursor biosynthesis
  Amino acid ligase
   J164_00902
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATP-grasp_3 ATP-grasp ATPgrasp_ST RimK
Motif
Other DBs
NCBI-ProteinID: AJY94223
UniProt: A0A0U5F8R7
LinkDB All DBs
Position
926578..927534
Genome map
AA seq 318 aa AA seqDB search
MSALVGNARTSDPAAFGRVAVLLGGTSSEREVSLNSGGNVLDALRARGVDAQPVDGIPAL
AKALVAQQFDRVFNVLHGHNGGGEDGIVQGLMEAFGVPYTGSDVLGSALSMDKIRTKQVW
LSLGLSTPRYARLAAGASAEDIHAAARQIGLPIIVKPANEGSSVGVSRVFDQAQLEEAVT
LAARYDGALLMEQLIEGDELTVAVLGDTALPSIRIVPKGQWYDYNAKYIADDTQYLCPGL
EGEAEAQIRQLALDAFRAAGCRGWGRVDVMRDGSSGQLYLLEVNTAPGMTSHSLVPKAAR
QLGIDFETLVWRVLEQTL
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcgttggtcggcaacgcccgcaccagcgatccggctgcctttggccgcgtcgcc
gtactgctcggcggcacctcgtccgagcgcgaggtgtcgttgaattccggcggcaacgtg
ctggacgcgctgcgcgcacgcggcgtggatgcgcagccggttgatggcattccggccttg
gccaaggcattggtcgcgcagcagttcgatcgcgtgttcaacgtgctgcacggacataac
ggcggcggcgaagacggcatcgtgcagggcctgatggaagccttcggcgtgccatatacc
ggctcggatgtgctgggttcggcgctgagcatggacaaaatccgcaccaagcaggtgtgg
ttgtcgctgggcctgtcgaccccgcgctatgcgcggctggccgctggcgcgagcgccgag
gacattcatgccgctgcacgccagatcgggttgccgatcatcgtcaagccggccaatgaa
ggttccagcgtcggcgtcagccgcgtgttcgaccaggcccagctcgaagaagcggtgacc
ctggcggcgcgctacgacggcgcgctgctgatggagcaactgatcgaaggcgacgaactc
accgtggccgtgctcggcgacaccgcgttgccgtcgatccgcatcgtgcccaagggccag
tggtacgactacaacgccaagtacatcgccgacgacacgcaatacctgtgcccggggctg
gaaggcgaggccgaagcgcagatccgccaactcgcgctggacgccttccgcgctgccggc
tgccgtggctggggccgcgtggacgtgatgcgtgatggcagcagtggccagctgtatctg
ctcgaagtcaacaccgctcccggcatgaccagccactcgctggtgcccaaggccgcccgc
cagctcggcatcgatttcgaaacgctggtctggcgcgtgctggagcagacgctatga

DBGET integrated database retrieval system