KEGG   Xanthomonas citri pv. citri MN12: J164_01258Help
Entry
J164_01258        CDS       T03735                                 

Definition
(GenBank) acyl carrier protein
  KO
K02078  acyl carrier protein
Organism
xcm  Xanthomonas citri pv. citri MN12
Pathway
xcm00998  Biosynthesis of various secondary metabolites - part 2
xcm01100  Metabolic pathways
xcm01110  Biosynthesis of secondary metabolites
xcm01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:xcm00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    J164_01258
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various secondary metabolites - part 2
    J164_01258
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PP-binding PP-binding_2 DUF1493 Ribosomal_L50
Motif
Other DBs
NCBI-ProteinID: AJY94562
UniProt: A0A0U5FAR7
LinkDB All DBs
Position
1278360..1278599
Genome map
AA seq 79 aa AA seqDB search
MSTIEERVKKIVVEQLGVKEEEVTTSASFVDDLGADSLDTVELVMALEEEFECEIPDEEA
EKITSVQQAIDYVKAHVKS
NT seq 240 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccatcgaagaacgcgtcaagaaaatcgtcgtcgaacaactcggcgtcaaggaa
gaggaagtcaccaccagcgcatcgttcgtcgatgatctgggtgccgactcgctggacacc
gtcgagctggtgatggcgctggaagaagagttcgagtgcgagatcccggacgaagaggcc
gagaagatcacctcggtgcagcaggcgatcgactacgtcaaggctcacgtcaagagctga

KEGG   Xanthomonas citri pv. citri MN12: J164_04230Help
Entry
J164_04230        CDS       T03735                                 

Definition
(GenBank) Acyl carrier protein
  KO
K02078  acyl carrier protein
Organism
xcm  Xanthomonas citri pv. citri MN12
Pathway
xcm00998  Biosynthesis of various secondary metabolites - part 2
xcm01100  Metabolic pathways
xcm01110  Biosynthesis of secondary metabolites
xcm01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:xcm00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    J164_04230
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various secondary metabolites - part 2
    J164_04230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PP-binding
Motif
Other DBs
NCBI-ProteinID: AJY97480
UniProt: A0A0U5GG60
LinkDB All DBs
Position
complement(4752884..4753153)
Genome map
AA seq 89 aa AA seqDB search
MSSQTAAERELAELLVESLNLEDVQPADIDPEAPLFNTGLGLDSIDALELALAISKRYGF
QLRSDNDENRRIFASLRALSAHVQANKTV
NT seq 270 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcgcaaaccgctgccgaacgtgaactggccgaactcctggtcgaaagtctgaac
ctggaagacgtccagcccgccgacatcgatccggaggcgccgttgttcaataccgggctg
gggctggactcgatcgacgcactggaactggcgctggcgatcagcaagcgctacggcttc
cagttgcgctcggacaacgacgaaaaccgtcgcatcttcgcgtcgctgcgcgcactgtcg
gcgcatgtccaagccaacaagaccgtctga

DBGET integrated database retrieval system