KEGG   Xanthomonas citri pv. citri MN12: J164_01749Help
Entry
J164_01749        CDS       T03735                                 

Definition
(GenBank) Kynureninase
  KO
K01556  kynureninase [EC:3.7.1.3]
Organism
xcm  Xanthomonas citri pv. citri MN12
Pathway
xcm00380  Tryptophan metabolism
xcm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xcm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    J164_01749
Enzymes [BR:xcm01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     J164_01749
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5 DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: AJY95046
LinkDB All DBs
Position
complement(1849043..1850314)
Genome map
AA seq 423 aa AA seqDB search
MTDPLSRAHAAALDAADPLRNLRDAFVFPQHGDDDQTYFVGNSLGLQPRAARAMVDEVLD
QWGALAVEGHFTGPTQWLTYHQLVGDALARVVGAQPGEVVAMNTLSVNLHLMMASFYRPT
AERGAILIEAGAFPSDRHAVESQLRLHGLDPATHLIEVEADEPNGTVSMSAIAEAIAQHG
PHLALVLWPGIQYRTGQAFDLAEIVRLARAQGAAVGLDLAHAVGNLPLTLHDDGVDFAVW
CHYKYLNAGPGAVGGCFVHARHATSDLPRMAGWWGHEQQTRFRMDPQFVPSPGAEGWQLS
NPPVLALAPLRASLALFDQAGMAALRAKSEQLTGHLEQMIHARVPQVLQIVTPVEPARRG
CQLSLRVAGGRARGRALFEHLHAAGVLGDWREPDVIRIAPVPLYNRFSDLHTFVEQVEAW
AAA
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacccgctgtcccgcgcccatgctgctgcactggatgccgccgacccgctgcgc
aacctgcgcgatgccttcgtgttcccgcagcacggcgatgacgatcagacctatttcgtc
ggcaattcgctcggcctgcagccgcgcgcggcccgcgcgatggtggacgaggtgctcgac
cagtggggtgcgctggcggtggaaggccacttcaccggcccgacccaatggctgacgtac
caccagttggtgggcgacgcgctggcgcgcgtggtcggtgcgcaacccggcgaagtggtg
gccatgaacaccctcagcgtcaatctgcatctgatgatggcgagcttctatcgtcccact
gccgagcgcggcgcgatcctgatcgaagctggcgcatttccgtccgaccgccatgcggtg
gaatcgcagctgcgcctgcacgggctggacccggccacgcatctgatcgaagtggaagcc
gacgaacccaacggcaccgtgtcgatgtcggccatcgccgaggccattgcgcagcatggt
ccgcacctggcgttggtgctgtggccgggcatccagtaccgcaccgggcaggccttcgac
ctagccgaaatcgtgcggctggcgcgcgcgcagggcgcggcggtgggtttagatctggcg
catgcggtgggcaatctcccgctgaccctgcacgacgacggcgtggatttcgcggtgtgg
tgccactacaaatatctcaacgccggtcccggcgcggtgggcggttgcttcgtgcacgcg
cggcatgcgacgagcgacctgccgcgcatggccggctggtggggacatgagcagcagacc
cgcttccgcatggacccgcagttcgtgccctcgcccggtgccgaaggctggcagctgagc
aatccaccggtgctggcgctggcaccgctgcgcgcctcgctggcgttgttcgaccaggcc
ggcatggctgcattgcgcgccaagtccgaacagctcaccgggcatctggagcagatgatc
cacgcgcgggtgccgcaggtgctgcagatcgtcacgccggtagaaccagcgcgacgcggt
tgccagctctcgctgcgggtggccggcggacgcgcacggggccgcgcgctgttcgagcac
ctccacgcagccggcgtgcttggcgactggcgcgaaccggacgtgatccgtattgcgccc
gtgccgctgtacaaccgcttcagcgatctgcataccttcgtggagcaggtggaagcctgg
gcggctgcttga

DBGET integrated database retrieval system