KEGG   Xanthomonas citri pv. citri MN12: J164_03172Help
Entry
J164_03172        CDS       T03735                                 

Definition
(GenBank) 3-dehydroquinate synthase
  KO
K01735  3-dehydroquinate synthase [EC:4.2.3.4]
Organism
xcm  Xanthomonas citri pv. citri MN12
Pathway
xcm00400  Phenylalanine, tyrosine and tryptophan biosynthesis
xcm01100  Metabolic pathways
xcm01110  Biosynthesis of secondary metabolites
xcm01130  Biosynthesis of antibiotics
xcm01230  Biosynthesis of amino acids
Module
xcm_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:xcm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    J164_03172
Enzymes [BR:xcm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.4  3-dehydroquinate synthase
     J164_03172
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHQ_synthase Fe-ADH_2 AlaDh_PNT_C Fe-ADH
Motif
Other DBs
NCBI-ProteinID: AJY96438
LinkDB All DBs
Position
3497679..3498791
Genome map
AA seq 370 aa AA seqDB search
MTLSRSSRSVDVDGAQPYTITIAPGLLADGARLASHVRGRHALLLSDSQVAPHYAAGVRA
ALSRARPDLQVGELVIAAGEASKTLETFGSAITALAELGATRDACVFALGGGVVGDLAGF
AAACWMRGVDCVQLPTSLLAMVDSSVGGKTAVDIPQGKNLVGAFHPPRAVIADTDTLRTL
PARELRAGLAEVIKYGAIRDPLFFQWLHAERRALLDGDAAALAQAIARSCEHKAEIVARD
PLEKGERALLNLGHTFGHAIETEQGYGAPGNDNLNHGEAVAVGMVLAARLSAALGMSDVQ
DTETLRALLHDFDLPTEIPPGLTPQALLARMRLDKKNIAGRLRLVLWRGIGKAEVVPDVE
EAAVLEILAG
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgacactttcccgttcttcgcgcagcgtcgatgtcgacggtgcgcagccttacaccatc
accatcgccccgggcctgctggccgacggtgcgcgcctggccagccatgtgcgcggccgc
cacgcgctgctgctcagcgactcgcaggtggctccgcattacgcggccggcgtacgcgcc
gccttgtcgcgcgcgcggccggatctgcaggtcggcgaattggtgattgccgccggcgaa
gcctccaaaaccttggagacctttggttctgcgatcaccgcactggccgaactcggtgcc
acccgcgacgcctgcgtgttcgcgctgggcggcggcgtggtcggcgacctggccggcttt
gcggcggcgtgctggatgcgcggcgtggattgcgtgcaactgcccaccagcctgctggca
atggtggattcgtcggtcggcggcaagaccgcggtggacatcccgcagggcaagaacctg
gtcggcgccttccatccgccgcgcgcggtgatcgccgacaccgacaccttgcgcaccctg
cccgcacgcgaactgcgcgccggcctggccgaggtgatcaagtacggcgccatccgcgac
ccgctgttcttccagtggctgcatgccgaacgccgcgccctgctcgatggcgatgcagcg
gcgctggcgcaggccatcgcccgcagctgcgagcacaaggccgagatcgtggcgcgcgac
ccgctggaaaaaggcgagcgcgccctgctcaacctgggccacaccttcggccacgccatc
gaaaccgagcaaggctacggcgcacccggcaacgacaacctcaaccatggcgaggccgtc
gcggtgggcatggtgctggcggcgcgcctgtcggccgcgctgggtatgagcgacgtgcag
gacaccgagacgctacgcgccttgctgcacgacttcgacctgcccaccgagatcccgccc
ggcctgacccctcaggccctgctcgcgcgcatgcgcctggacaagaagaacatcgccggc
cgcctgcgcctggtgttgtggcgcggcatcggcaaggccgaggtggtgccggatgtggaa
gaggcagcggtgctggagatcctggccggataa

DBGET integrated database retrieval system