KEGG   Xanthomonas citri pv. citri NT17: J169_00919Help
Entry
J169_00919        CDS       T03734                                 

Definition
(GenBank) Glycosidase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
xcn  Xanthomonas citri pv. citri NT17
Pathway
xcn00500  Starch and sucrose metabolism
xcn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xcn00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    J169_00919
Enzymes [BR:xcn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     J169_00919
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase
Motif
Other DBs
NCBI-ProteinID: AJY89769
UniProt: A0A0U5F8M9
LinkDB All DBs
Position
complement(947237..948664)
Genome map
AA seq 475 aa AA seqDB search
MRNTPAHAPPSLIQCGVRLLLTALVLLVTTANAQADVILHAFNWPYATVEARAKQIADAG
YRKVLVAPAYRSEGSAWWARYQPQDIRLIDNPLGDTAAFKKMVQALASNGVETYADIVFN
HMANEAATRSDLNYPGGAVLSQYAANPGRYDSLRLFGTLQSNFLSASDFGPAQCISNYND
AYQVRNYRICGGGSDPGLPDLLGNDWVVQQQRAYLQALKSMGVTGFRVDAAKHMTFDHLN
RVFDAGIRSGVYVFGEVITGGGTGNGDYDQFLAPYLQSTPHAAYDFPLFNAVRNAFAIGA
SMQQLVDPAASGQALPGNRAVTFAVTHDIPNNAGFRYAILDPVDETLAYAYLIGRNGGMP
MLYTDNNESGDNRWVNAYLRDDLRRMIGFHNGVQGTDMQVLSSSSCHILFRRGSLGIVGI
NKCGNPVTTTVGMNNSVLYWNADYVDALGSGNVVRISSSSYTFTLPARGARMWRR
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaacacgcctgctcatgctccaccctcactgatacaatgcggtgtccgtctcttg
ctgactgcattggtcctgctggtgaccaccgccaacgcgcaggccgatgtcatcctgcac
gccttcaactggccgtatgccaccgtggaagcgcgcgccaagcagattgccgatgccggc
tatcgcaaggtattggtcgcccccgcgtaccgctccgaaggaagtgcctggtgggcgcgc
tatcaaccccaggacatccgcctgatcgacaatccgctcggcgacaccgctgcattcaag
aagatggtccaggcgctggccagcaacggcgtggaaacctatgccgacatcgtgttcaac
cacatggccaacgaagcggccacacgctcggacctcaattacccaggcggcgcggtcctg
tcgcagtacgcggcaaaccccggccgttacgattcgctgcgcttgttcggcacgctgcag
tcaaacttcctcagcgccagcgatttcggcccggcgcagtgcatcagcaactacaacgac
gcttaccaggtgcgcaattaccgtatctgcggcggcggcagcgatccaggcctgccggat
ttgctgggcaacgactgggtggtacagcagcagcgcgcctatctgcaggcgctcaagagc
atgggcgtgaccggcttccgggtggatgcggccaagcacatgacgttcgaccatctcaat
cgcgtcttcgatgccggcatccgatcgggtgtgtatgtcttcggcgaagtgatcaccggc
ggcggtacgggcaatggcgattacgaccagttcctggcgccgtacctgcaatccacgccg
catgcggcctacgactttccgctgttcaatgcggtgcgcaacgcgttcgccattggcgcc
agcatgcagcagctggtggatcccgccgcgtccggacaggcattgccgggcaatcgcgcc
gtgacctttgcagtgacccacgacattcccaacaacgccggattccgctatgcgattctc
gacccggtggatgaaacgctggcctacgcgtacctgatcggtcgcaacggcggcatgccg
atgctttataccgacaacaacgaaagcggcgacaatcgctgggtcaacgcttatctacgc
gacgatctgcgccgcatgatcggcttccataatggcgtgcagggcaccgacatgcaggtc
ttgtcgtccagctcctgccacatcctgttccgtcgcggcagcctgggcatcgtgggcatc
aacaagtgcggcaacccggtcaccaccacggtgggaatgaacaacagcgtgttgtactgg
aatgccgattacgtggatgccttgggctcgggcaacgtagtgcgcatttccagtagttcc
tacacctttacgctgccggcgcgcggggcgcgcatgtggcgccgctga

DBGET integrated database retrieval system