KEGG   Xiphophorus couchianus (Monterrey platyfish): 114133189
Entry
114133189         CDS       T05908                                 

Definition
(RefSeq) cullin-3
  KO
K03869  cullin 3
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04120  Ubiquitin mediated proteolysis
xco04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:xco00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    114133189
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    114133189
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:xco04121]
    114133189
   03400 DNA repair and recombination proteins [BR:xco03400]
    114133189
Ubiquitin system [BR:xco04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Cullin
     114133189
DNA repair and recombination proteins [BR:xco03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     114133189
SSDB
Motif
Pfam: Cullin Cullin_Nedd8 Phage_antitermQ
Other DBs
NCBI-GeneID: 114133189
NCBI-ProteinID: XP_027854678
LinkDB
Position
18
AA seq 767 aa
MSNLSKGGTKKDTKMRIRAFPMTMDEKYVNNIWDLLKNAIQEIQRKNNSGLSFEELYRNA
YTMVLHKHGEKLYTGLREVVTEHLINKVREDVLNSLNNNFLQTLNQAWNDHQTAMVMIRD
ILMYMDRVYVQQNNVENVYNLGLIIFRDQVVRYGCIRDHLRQTLLDMIARERKGEVVDRG
AIRNACQMLMILGLEGRSVYEEDFEAPFLEMSAEFFQLESQKFLSENSASVYIKKVEARI
NEEIERVMHCLDKSTEEPIVKVVERELISKHMKTIVEMENSGLVHMLKNGKTDDLACMYK
LFSRVPNGLKTMCECMSSYLREQGKALVSEEGEGKNPVDYIQGLLDLKSRFDRFLQESFN
NDRLFKQTIAGDFEYFLNLNSRSPEYLSLFIDDKLKKGVKGLTEQEVESILDKAMVLFRF
MQEKDVFERYYKQHLARRLLTNKSVSDDSEKNMISKLKTECGCQFTSKLEGMFRDMSISN
TTMDEFRQHLQTTGVSLGGVDLTVRVLTTGYWPTQSATPKCNIPPSPRHAFEVFRRFYLG
KHSGRQLTLQHHMGSADLNATFYGPIKKEDGSEVGVGGAQVTGSNTRKHILQVSTFQMTI
LMLFNNREKSTFEEIQQETDIPERELVRALQSLACGKPTQRVLTKEPKSKEIENGHVFTV
NDQFTSKLHRVKIQTVAAKQGESDPERKETRQKVDDDRKHEIEAAIVRIMKSRKKMQHNV
LVAEVTQQLRARFLPSPVVIKKRIEGLIEREYLARTPEDRKVYTYVA
NT seq 2304 nt   +upstreamnt  +downstreamnt
atgtccaatctcagcaaaggcggcaccaagaaggacaccaaaatgaggataagggccttt
cctatgacgatggatgagaagtatgtcaacaatatctgggacctactaaaaaatgccatc
caggaaatacagaggaagaacaacagcggcctgagctttgaggaactttacaggaatgcc
tacacaatggtgctccacaaacatggagagaaactgtacacaggcctgcgggaagttgtc
actgaacatctcatcaacaaagtacgagaagatgtcctaaactctctaaacaataacttc
ctccagacgttaaatcaagcgtggaacgaccaccagactgcaatggtgatgatcagagac
atcctgatgtacatggatcgagtgtatgtgcagcaaaataatgtagaaaacgtctacaac
ctggggctcatcatctttagggatcaggtggttcgatatggctgcatcagagaccacctt
cgacaaactctgcttgacatgatcgcacgggagaggaagggggaagtggtggacaggggg
gccattagaaatgcctgccaaatgttaatgatccttggccttgaaggaagatctgtttat
gaagaagactttgaagcaccgttcttggaaatgtctgcagaatttttccagctggagagc
caaaagttcctttcagaaaacagtgcgagtgtgtacataaagaaggtagaggccagaatt
aatgaggagattgagcgggtaatgcactgcctggacaaatcaacagaggagcccatcgtc
aaggtggtggaacgagagctcatctccaagcacatgaagaccatcgtagagatggagaac
tcgggtctggtccatatgctgaagaatggcaagacagatgatttagcatgtatgtacaag
ctgttcagtcgggttcccaacgggctgaagaccatgtgtgagtgtatgagctcatacctg
cgggagcaaggcaaggcgctcgtttcagaggagggagaaggaaaaaatccagtagattat
attcagggtttgttagacctgaagtcacgttttgaccgtttcctccaagaatctttcaat
aatgaccgactcttcaaacaaactattgctggtgatttcgagtacttccttaacctcaac
tctcgctcacctgaatatctctcgctcttcatcgatgacaaactgaagaagggagtaaaa
gggctaacagagcaagaggtggagtccatactggacaaggccatggtgttgttccgcttc
atgcaggagaaggatgtgtttgaacgatattacaagcagcacctggctcgaaggttgctc
accaacaagagcgtctcagatgattcagaaaagaacatgatctccaagctaaagactgag
tgtggttgtcagttcacctctaaactagagggaatgttccgggacatgagcatctccaac
accaccatggatgagttcaggcaacatctccagaccactggggtttctcttggaggggtt
gatctcactgtgagggtcctgactacaggatactggcctacacaatcagcaacaccaaag
tgcaatatccccccttcaccacgtcatgcatttgaagttttcagaaggttttatctcggt
aagcacagtggtagacaactcaccttacagcaccatatgggttctgcagatttaaatgcc
accttctatggtcccatcaaaaaggaggacgggtcagaagtcggagtaggtggggcccag
gtgacgggctccaacaccagaaagcacattctgcaagtatccacctttcagatgaccatt
ctcatgcttttcaacaacagggagaagtccacttttgaggaaatccagcaggagacggat
atccctgagagggagctggtgcgagcgctgcagtctctggcctgtgggaagcccacacag
agagttctcaccaaagagcccaaatccaaggagattgaaaatggccatgtgtttacagtg
aatgaccagtttacctctaaactgcaccgggtcaaaattcagacggtggctgctaaacag
ggagagtctgatccggagaggaaggagacgcgacagaaagttgatgatgacagaaagcat
gagattgaagcagccattgttcgcatcatgaaatctagaaagaagatgcagcacaatgtc
ctagtagcagaggtcacacagcagttgcgagcacgattccttcctagtccagtagtcatc
aagaagcgcattgaaggactcattgagagggaatatttggcaagaacaccagaggaccgc
aaagtgtacacttatgtagcataa

KEGG   Xiphophorus couchianus (Monterrey platyfish): 114146168
Entry
114146168         CDS       T05908                                 

Definition
(RefSeq) cullin-3-like
  KO
K03869  cullin 3
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04120  Ubiquitin mediated proteolysis
xco04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:xco00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    114146168
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    114146168
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:xco04121]
    114146168
   03400 DNA repair and recombination proteins [BR:xco03400]
    114146168
Ubiquitin system [BR:xco04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Cullin
     114146168
DNA repair and recombination proteins [BR:xco03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     114146168
SSDB
Motif
Pfam: Cullin Cullin_Nedd8 Phage_antitermQ
Other DBs
NCBI-GeneID: 114146168
NCBI-ProteinID: XP_027875803
LinkDB
Position
6
AA seq 766 aa
MSNLKGGTKKDTKMRIRAFPMTMDEKYVNNIWDLLKNAIQEIQRKNNSGLSFEELYRNAY
TMVLHKHGEKLYTGLREVVTEHLINKVREDVLNSLNNNFLQTLNQAWNDHQTAMVMIRDI
LMYMDRVYVQQNNVENVYNLGLIIFRDQVVRYGCIRDHLRQTLLDMIARERKGEVVDRGA
IRNACQMLMILGLDGRSVYEEDFECPFLDMSAEFFQMESQKFLAENSASVYIKKVEARIN
EEIERVMHCLDKSTEEPIVKVVERELISKHMKTIVEMENSGLVHMLKNGKTEDLACMYKL
FSRVPNGLKTMCECMSSYLREQGKALVSEEGEGKNPVDYIQGLLDLKTRFDHFLLESFNN
DRLFKQTIAGDFEYFLNLNSRSPEYLSLFIDDKLKKGVKGLTEQEVESILDKAMVLFRFM
QEKDVFERYYKQHLGRRLLSNKSVSDDSEKNMISKLKTECGCQFTSKLEGMFRDMSISNT
TMDEFRQYIQSISASLSGVDLTVRVLTTGYWPTQSATPKCTIPPAPRDAYEVFRRFYLAK
HSGRQLTLQHHMGGADLNATFYGTIKKEDGSEVGVGGAQVTGSNTRKHILQVSTFQMTIL
MLFNNREKCTFEDIQQETDIPERELVRALQSLACGKPTQRVLTKEPKSKEIENGHVFTVN
DQFTSKLHRVKIQTVAAKQGESDPERKETRQKVDDDRKHEIEAAIVRIMKSRKKMQHNVL
VAEVTQQLRARFLPSPVVIKKRIEGLIEREYLARTPEDRKVYTYVA
NT seq 2301 nt   +upstreamnt  +downstreamnt
atgtccaacctcaaaggcggcaccaagaaggacaccaagatgaggatacgagcctttcct
atgacgatggatgagaaatacgtaaataacatctgggaccttctgaaaaatgccattcag
gagattcagaggaagaacaacagcgggctgagctttgaggagctttacaggaatgcctac
accatggtgctccacaagcatggagagaagctctatacaggcctaagggaagtggtcaca
gagcacctcatcaacaaagtacgggaagatgttctaaactccttaaacaataactttctg
caaacactgaaccaggcttggaatgaccatcaaactgccatggttatgatcagagacatc
cttatgtacatggatagggtttatgttcagcaaaacaacgtggagaatgtatacaacctc
ggcctaatcatattcagggaccaggtggtacgctacggctgcattcgggaccacctacga
cagacgttgctggacatgattgcgcgggaaagaaagggggaagttgtagacaggggtgcc
atcagaaacgcctgccagatgctgatgattctcggcctggacggtagatctgtatacgag
gaggacttcgaatgccccttcttagacatgtcagctgaattcttccagatggagagccaa
aagttcctggcagaaaacagtgccagcgtctacataaagaaggtcgaggctaggatcaat
gaagagattgagcgagttatgcactgcttagacaagtcaactgaagagccaatcgttaag
gtagtggaaagggagcttatttcaaaacatatgaaaactattgtggagatggagaattct
ggcttggtgcatatgctcaagaatggaaaaacggaagatctggcttgcatgtacaagcta
ttcagtcgagtaccaaatggcctgaaaacaatgtgcgagtgtatgagctcatacctgagg
gaacagggcaaagctctggtgtcagaagagggagagggcaagaaccctgttgattacatt
cagggtctgctagacttgaaaacacgatttgatcatttcctcctcgagtctttcaataat
gacagactctttaagcaaactatcgctggagactttgagtattttcttaacctcaactca
cgttcaccagagtacctgtcactgttcatagacgataagctcaagaagggagtaaaaggg
ctgacagaacaggaggtggagtctattctcgacaaggccatggtgttgttcaggtttatg
caggagaaggacgttttcgaaagatactacaagcagcatctgggccgtcgacttctcagc
aacaagagtgtctcggatgattccgagaagaacatgatctctaagctgaagacagaatgt
ggctgtcagttcacctctaaactggaaggaatgttcagagacatgagtatctcaaacact
actatggatgagttcaggcaatacattcagagcatatcggcttctttaagtggtgtagac
ctaacagtgagggtccttaccacgggttactggcctacacagtctgcaacacccaagtgc
accatccctcctgctcctagagatgcatatgaagtcttcagaaggttttaccttgctaag
cacagtggaaggcagctcacactacaacatcacatgggtggagcagacctaaatgcaacc
ttttatggaactatcaaaaaggaggatggttcggaggttggtgtcggtggagcacaggtg
acaggttctaacacccgaaagcacatcttgcaggtctccaccttccagatgaccatcctc
atgctcttcaacaacagggaaaagtgcacttttgaggacatccagcaggagacagacatc
ccagagagagagctggtgcgggcgttgcagtctttagcctgtggaaaacctacacaaaga
gttctaacaaaagagccaaagtcaaaagagatcgaaaatggccatgtgtttacagtcaat
gatcagtttacctccaagctgcacagagtcaaaatccagacagttgctgctaaacaagga
gaatcggatcctgaaagaaaggagacacgacagaaagtcgatgatgacaggaagcatgag
atcgaggcagccatcgtccgcatcatgaagtcgaggaagaagatgcagcacaatgttctg
gtagcagaggtgacccagcagctccgagcacggtttcttcccagtcctgtggtaatcaaa
aagcgcatcgaaggactgatagaaagagaatacttggcacggacgccagaggatcgcaaa
gtgtacacctacgtggcgtag

DBGET integrated database retrieval system