KEGG   Xiphophorus couchianus (Monterrey platyfish): 114133260
Entry
114133260         CDS       T05908                                 

Gene name
cdon
Definition
(RefSeq) cell adhesion molecule-related/down-regulated by oncogenes
  KO
K20033  cell adhesion molecule-related/down-regulated by oncogenes
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:xco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    114133260 (cdon)
SSDB
Motif
Pfam: Ig_3 fn3 I-set ig Ig_2 V-set Pur_ac_phosph_N C2-set_2 Y_Y_Y
Other DBs
NCBI-GeneID: 114133260
NCBI-ProteinID: XP_027854804
LinkDB
Position
18
AA seq 1106 aa
MDSGLRVLLSTVLWLSQIISCSTQYPSLRSEPTSVVQSPGSAVHLQCSASPPSAAVSWRF
RGRPLDRDSLPGVELGRGSLVISSLTPDHAGVYQCVARSGRGPAVASRLARVALAEISEY
EAGRQPAVSAQEGSTAVVECPLPRSAPPARPKLRVRGDWIEESRDNYLLLPSGNLQIVSV
SAQHQGMYKCGAVNPVTGETVVQSHGVKLLVKRSSSSSSSSPLVRIVYPTAPVSVSMLHS
EPLTLECVVSGSPAPAAAWFKDGQEVASGPSLQRRNNNLEFTRLARSDEGRYSCRVQTER
GTAIGPDYTVNVLEPASIVDGPGDQLVPLGSSARFTCSARGNPSPNVTWLFNAEPVAPSL
RLQISGSSLVVSDATPQDEGVYQCLLDNGIGSAQSHGFLTIQSDPQLGSTAVLLPKASPS
FHPIQSDESFLTEDDDPFNAPADRSGDRPTPEAPIIISPPQTHKPDVYNLEWRAGRDGGS
PINAYFVKYRKVDDMGAVVGSWQTVRVPGSEKTLRLSELEPSSLYEVLMVARSAAGEGQP
AMLTFRTGKEKTISPSNKNPSKPSSIPVPPKVPEDRPTKTNYGVVLHDRLPEAPDRPTIS
MATDSSVYVAWIPRANGGSPVTAFRVEYRRGRSAEWIVAADNISPLKLSVEIRNLEPGST
YRFRVLASNTYGDSLPSTPSKPYQVPNASPHKADRPVAGPHILATDAISDTQIMLRWTYD
PSSNNNTPIQGFYIYYRPTDSDNDSDYKRDVVEGVKTWHMIGHLQPETSYDIKMQCFNGG
GESDYSNVMICETRARQSPDSPSQHPFTPPGPHPPDPPTPPGGLLYLIVGCVLGVMVLIL
LSFIAMCLWRNRQQNNMHKYDPPGYLYQPADLNGHVLEYTTLTTGGGRVNGGVHGGYGGQ
MLPQGCHHLHHKLPNGLTLLNGSGGFVPHGHDGTLPHSTHECEHPHPHHHLNGGSLYTAL
PQKETSECMSCQNLCNNNRCYNKTNGAAPLMHRVAPCHQDGLEMVPLGQVSPQCRGSDPD
AGFQPPDGNRGSSPSQHSCCLIRNNENSQGDSTAEDEPEDSVETEDQVVSSWDGLGLPDL
DCDEKPGWISSSSLVGELIPAGPQEA
NT seq 3321 nt   +upstreamnt  +downstreamnt
atggacagtggcctaagggtcctcctgtccactgtgctgtggctcagccagattatcagc
tgctcaactcagtatccgtctctccgctctgagccaacctctgtggtccagagtccaggt
tctgcggtccatctgcagtgctcggcgagccctccgtcggcggcggtttcctggcgcttc
cgaggccgtcccctggaccgggactcgctgcctggggtggagcttggccgcggctccctc
gtcatctccagcctcacgcccgaccacgccggcgtctatcagtgtgtggcgcgctcgggg
cgcgggccggccgtcgccagccgccttgcccgggtggctttagcagaaatatcagaatac
gaagctggccgacagccggcggtgtcggcgcaggaaggcagcacggcggtcgtagagtgt
ccgctgccgcgcagcgctccgccggctcggcccaaactgagagtcagaggcgactggatc
gaagagtcgagagataactatttattacttccatccggcaacctgcagattgtctcggtg
tcggcccagcaccagggcatgtataagtgcggcgccgtgaaccctgttaccggggaaacc
gttgttcagtcccatggcgtcaagctgctagtcaaacgatcctcttcctcctcctcctcc
tccccgttggttcggatagtttatcccaccgctccggtgtcggtttcgatgctgcattcg
gagccgctgacgttggagtgcgtcgtctctgggagtcctgcgcctgcagccgcgtggttt
aaggacggtcaggaggtcgcatcggggccttcgctccagagacggaacaacaacctggag
ttcacgcggctggcgaggagcgatgaagggcgctacagctgcagggtccagaccgagcgg
ggcacggcgatcggccccgactacactgtaaacgttctcgaacccgcctccatcgtcgac
ggaccgggtgaccagcttgttcctctgggctcttctgctcgtttcacctgctcagcgaga
ggaaacccgtccccgaacgtcacctggctgttcaacgccgagcccgtcgctccatctcta
cgtctacaaatctccgggtcctcgctcgtggtgtcagacgcgacgccgcaggacgaaggc
gtgtaccagtgtctgctggacaacggcatcggctcggcgcagtcgcacgggttcctcacg
atacagtcagatcctcagttgggatccactgccgttctgctgcccaaagcttcaccgtcg
tttcatccgattcaaagcgacgagagcttcctgaccgaagacgacgacccgtttaacgcg
ccggccgaccggagcggcgaccggcccactccggaggcgccgatcatcatcagcccgccg
cagacgcacaaaccggacgtttacaacctggagtggagagcgggccgagatggaggcagt
cccatcaacgcttactttgttaaataccgcaaggttgacgacatgggagcagtggtgggg
agctggcagacggtccgagtccccggcagcgagaaaaccctgcggctgtcggagctggag
ccctccagcctctacgaggttctgatggtggctcggagcgcagcgggcgagggtcagccg
gccatgctcacgttccgcacaggaaaagaaaagaccatctctcccagtaataagaatcct
tccaagccttccagcatcccagttccacccaaggttccagaggacagacccacgaagaca
aactatggcgtcgtcctccatgacagacttccagaagctcccgaccgtccaaccatctcc
atggcaaccgacagttcggtctacgtggcatggatccctcgagccaacggcggctccccg
gtcacggcgtttcgagtggagtacaggcgcggccgcagcgcggagtggatcgtggcggcg
gataacatctcgcctctgaagctgtctgtggaaatccgcaatctggagcctgggtccacc
tacaggtttcgggtcctggcttcgaacacgtacggcgacagcctgcccagcacgccctcc
aagccgtaccaggtccctaacgccagccctcacaaggccgaccggcccgtggccggaccg
cacatcctggccacggacgccatcagcgacacgcagatcatgctgcgctggacctatgac
ccctcgagtaacaacaacactccgatccaaggcttctacatctactacagacccacggac
agcgacaatgacagcgactacaaaagagacgtggtggaaggtgtgaaaacctggcacatg
attggccacctgcagccagagacgtcctatgacatcaaaatgcaatgtttcaatggcggt
ggggagagcgactacagcaacgtgatgatctgtgagaccagagctcgtcagtctccggat
tcgcccagtcagcaccccttcaccccgcccggcccgcatcctccagaccccccgacgccg
cccggcggtctgctgtacctgattgtcggctgcgtgctgggagtgatggtgctcatcctg
ctgtccttcatcgccatgtgtctgtggaggaaccggcagcagaacaacatgcacaagtat
gaccctcctggctacctgtaccagccggcggacctgaacggccacgtgctcgagtacacc
acgctgacgacgggcggcgggcgcgtgaatggaggcgttcacggcggctacggcggccag
atgttgcctcagggctgccatcacctccaccacaaactccccaacggcttgacgttgctc
aacggctccggcggcttcgtaccgcacggccacgacggcaccctgcctcacagcacccac
gagtgcgagcacccgcacccccaccaccacctgaatggtgggagtttgtacacggctctt
cctcagaaagagacatcagagtgtatgagctgccagaacctctgcaacaacaacagatgc
tacaataaaaccaacggcgctgcgccgttaatgcaccgcgtggcgccgtgccaccaggac
gggctggagatggttccgctgggccaggtttccccgcagtgccgcgggtcggaccccgac
gccggcttccagccgccagacgggaacagagggtcgtcgccttcccagcattcctgctgt
ctgatccggaacaatgaaaactctcagggggacagcaccgcggaggacgagccggaggac
agcgtggagacggaggaccaggtggtgtcctcctgggacgggctgggcctgccggacctg
gactgtgacgaaaagcccggctggatctccagcagtagcctggtgggagagctgatcccg
gccggcccacaggaggcctga

KEGG   Xiphophorus couchianus (Monterrey platyfish): 114136683
Entry
114136683         CDS       T05908                                 

Gene name
boc
Definition
(RefSeq) brother of CDO
  KO
K20020  brother of CDO
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:xco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    114136683 (boc)
SSDB
Motif
Pfam: I-set Ig_3 Ig_2 fn3 ig V-set C2-set_2 Pur_ac_phosph_N Ig_4 Ig_5 Ig_C17orf99 BiPBP_C G6B
Other DBs
NCBI-GeneID: 114136683
NCBI-ProteinID: XP_027860655
LinkDB
Position
21
AA seq 1044 aa
MSGKQDWTPWMKKRKAPVFCALGAVLLCCLQSGASTTYEVPVFTEEPVSVVQKLGGSVML
RCSARPASAKLSWYLNGEQLSNGDLGVVLSLGSLLIPALTNRTLGRYQCVASTGAGSLAS
VPANVTAAKLRDFEPDIQQEIEVDEGNTAVIECHLPESQPKAQVRYSVKQEWLETSKGNY
LIMPSGNLQIANATQDDEGPYKCAAYNPVTQEVKTSRSTDRLRIRRSMSEAARIIYPPAP
RSIMVTKGQRLVLECVASGIPTPQVTWAKDGLDLRSHNNTRFLLSNLLIDAVSEGDSGTY
VCKADNGMGSDRSATMLYDVQVFEPPLVTIELQQQEVAFGETVRIICQARGNPTPSVTWL
HNARPLAQSSRHRLTSRALRISNVSSQDDGLYQCMAENGLGSSQASARLITVSTGISSRG
RLPPNFRPLSPDKVLKEQPPVRPGAAGAMLPLDCSSLPGQILPAEAPIILSQPRTGKADY
YELTWRPRHERGSPVLEYVIKYRKEGPPLAEWITRSISGSLHKLILTKLQPDSLYEVEMA
AKNCAGLGQPAMMTFRTGKVRKGSGASNDPPKTPAVPSPSLSPPEAPDKPTVSMATETSA
YVTWIPRGNRGFPIQSFRVEYKKVKRPGEDWVTAVENIPPSRLSVEITGLEKGTSYKFRV
VAVNVIGSSPPSAPSKAYTVVGGKTHERPVDGPYITYNEAINETTIILKWTYDPVNNTPI
YGFYIYYRPTDSDNDSDYKKDVVEGDRYWHSITDLQPETAYDIKMQSFNEKGESEFGNVV
ILETKARLNNPRPRAPEPIDPEAEAPGVLVPRPGDLPYLIVGIVLGAFVFIIVAFIPFCL
WRAWAKQKQASDLCFPTVAAPVSACQYTMVPLQGLALVGHCPLDSHMSPSRNVYPANGEY
IQNGKAQHCLPGLQQDGVDCDLECNTLLPQANGHLPLYQYSSREVDHQEQSHCSPDDSTH
QLLASSHEFVSSQEVGGGVRFGDGTPNINQKQEPLRLLSLEDDGVFTSYSTTTMQQSQDT
IQEVNILPNEVSSENIGTSDTTDA
NT seq 3135 nt   +upstreamnt  +downstreamnt
atgtctggaaagcaagactggactccttggatgaaaaagagaaaagctccagtgttttgt
gctctgggtgcagttctgctgtgctgcctgcagagcggcgcttcaaccacttatgaggtg
ccggtgttcactgaggagcccgtgtctgtggtgcagaagctgggaggcagcgtcatgttg
cgctgcagcgcccgacccgcctcagccaagctcagctggtatctcaacggcgagcagctg
tcgaacggcgatctgggcgtggtgctgagcctgggcagccttctcatccccgctttgacc
aaccggacgctgggcagataccagtgtgtggccagcaccggcgctggttctctggcgagc
gtgcctgctaatgtcaccgctgccaagctacgggatttcgagcccgacatccaacaggag
atagaagtcgatgaaggcaacacggccgtcatcgagtgtcaccttccggagagtcagccc
aaagctcaggtccgctacagtgtcaaacaggaatggctggagacgtccaaaggaaactac
ctcatcatgccatcagggaacctgcagatagccaacgccacccaggacgacgaggggccg
tacaagtgtgccgcttacaatcctgtcactcaggaggtcaaaacgtccagatccaccgat
cgcctgcgcattcgccgctccatgtccgaagcggctcgcatcatctacccgccggcgccc
cgatccatcatggtgaccaaaggccagcggctagtgctggagtgcgtggccagcggcatc
cctaccccgcaggtcacctgggcgaaagacgggctggacctgcgctctcacaacaacacg
cgctttctgctgagcaacctgctcatcgacgccgtgagcgagggcgattcgggcacgtac
gtctgcaaagcggacaacggcatgggctcggaccgatccgccaccatgctctacgatgtt
caagtgttcgagcctccactggtgaccatagagctgcagcagcaggaggttgcgttcgga
gaaactgtgcggatcatctgccaggcccgaggaaatcccactccctcagtgacgtggctc
cataatgcccgacccctcgctcagtcctcccgccaccgcctcacctcgcgggcgctgcgc
atctccaacgtgagctctcaggatgatggcctgtaccagtgcatggcggagaacgggctg
ggcagttcgcaggcatctgctcgcctcatcacggtatcgaccgggatttcatctcgggga
aggctgcctcctaattttcgcccactcagtcctgataaagtgctgaaagagcagccacct
gtaaggcctggggccgccggagccatgctgcctctggactgctcctcattaccaggacaa
atattacctgcagaagcccccattattctcagccagcctcgaacaggcaaggcagactat
tatgagctgacctggagacctcggcatgaacgagggtcccctgtgctggagtatgtgatc
aaatacagaaaggagggtccccctcttgctgagtggatcactcgaagtatctcaggttcc
ctccataagctgattctaaccaaactgcagccagacagcctgtatgaagtagagatggct
gcaaagaattgtgctggtttgggacagccagccatgatgaccttcaggactggcaaagtg
cgtaaaggctccggagcgtccaacgacccaccaaaaaccccagctgtcccttcaccgagc
ctctctcctcccgaagctcccgataagcccaccgtctccatggctacggagacctcggca
tacgtgacttggattcctcgtggcaaccgcggcttccccattcagtcgtttcgggtggag
tacaagaaggtgaagaggcccggggaggactgggtgacggcggtggagaacattccccca
tccaggctgtctgtggaaatcacgggcctggagaaaggtacgtcctataagtttcgtgtg
gtcgccgtgaacgtaatcggttccagtccacccagtgccccctccaaggcctacactgtg
gtgggtgggaaaacccacgagcgtcccgttgatggaccttacatcacttacaatgaagcc
atcaatgagaccacgatcatcctgaaatggacgtatgatcctgtgaacaacacgccaatc
tatggtttctacatctactaccgcccgacggacagcgataatgacagcgactacaagaag
gatgtggtggagggggaccggtactggcattcgatcactgacctgcagccagaaactgcg
tacgacatcaaaatgcagagcttcaacgaaaagggcgagagcgagtttggcaacgtagta
attcttgaaactaaagctcgtcttaataacccgcgacctcgggctccagagcctatagat
ccagaggctgaagcccccggcgtgctagtgccacggcctggtgacctcccctatctcatc
gttggtattgtcctaggagcctttgtcttcatcattgtcgccttcatcccgttctgtctc
tggagagcctgggccaagcagaagcaagcatcagacttatgcttcccaactgtggctgct
ccggtctcagcgtgtcagtacaccatggttcctctgcagggactggccctggtaggacac
tgtcccctggactctcacatgagtccttcacgcaacgtttaccccgctaacggagagtac
atccagaacggaaaagctcagcactgccttccaggactgcagcaggatggagtggattgt
gacttggagtgcaacacgcttctgccacaggcaaatggacatctgcctctttaccagtac
tccagcagggaggtggatcatcaggaacagagccactgttctcctgacgactccactcat
cagcttctggcgtcttcccatgaatttgtcagctcacaggaagtaggaggcggagttagg
tttggtgacggcacgccaaacatcaatcaaaaacaggaacctcttcgtcttttgtcactt
gaggacgatggagttttcacctcctattccacaaccacaatgcaacaatcccaagataca
atacaggaagtaaacatcctcccaaatgaagtgtcctctgagaacatagggacatcagac
accacagatgcataa

KEGG   Xiphophorus couchianus (Monterrey platyfish): 114143565
Entry
114143565         CDS       T05908                                 

Definition
(RefSeq) growth arrest-specific protein 1-like
  KO
K06232  growth arrest-specific 1
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:xco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    114143565
SSDB
Motif
Pfam: GDNF
Other DBs
NCBI-GeneID: 114143565
NCBI-ProteinID: XP_027871523
LinkDB
Position
4
AA seq 246 aa
MRCQCSSLALLLWLLVALDAQLVCWQAILKCHNEPECELAYNQYLAACEGNIHGTRSQCP
SHCIQALIRLNNTRSGPDLETCDCVQDPDCLGAKRAIEPCLPRRHPSDAGGIGCMEARQR
CEEDSGCHASLSAYLSYCGQLFNGRRCTSRCKATIQQMLFIPNGMLLNRCVCDGVERPFC
EVVKDNMSKLCSIGDHSVASDQPEVEIYDYEDDDRKVDREEGYTDSSSACQRLPSFMMFV
FLWILF
NT seq 741 nt   +upstreamnt  +downstreamnt
atgagatgtcagtgcagctcgctggcgcttctcctgtggctgctggtggctttggacgcc
cagctagtctgttggcaggcgatcctgaagtgccacaacgagcccgagtgtgagctcgcc
tacaaccagtacttggcggcatgcgaggggaacatccacgggacgaggagccagtgcccg
agccactgcatccaggcgctgatccggctcaacaacacccgcagcgggccggatctggag
acctgtgactgcgttcaggacccggactgcctcggcgcgaagcgggccatagagccgtgc
ctgccccgcagacaccccagcgatgcagggggcatcggctgcatggaggcccgccagcgg
tgtgaggaggacagcggctgccacgcctccctttcggcctacctgtcgtactgcgggcag
ctgttcaacggcaggcggtgcacctccaggtgcaaggccaccatccagcagatgctgttc
atcccgaacggcatgctgctgaaccgctgcgtttgtgacggcgtggagagacctttctgc
gaggtggtcaaggacaacatgagcaagctttgttccattggggaccacagcgttgcttct
gaccaacctgaagttgagatctacgactatgaggatgatgatcgaaaagttgacagagag
gagggttacactgacagctcctctgcgtgccagaggttacccagcttcatgatgtttgtc
tttctatggatattattctga

KEGG   Xiphophorus couchianus (Monterrey platyfish): 114148390
Entry
114148390         CDS       T05908                                 

Gene name
lrp2
Definition
(RefSeq) low-density lipoprotein receptor-related protein 2 isoform X1
  KO
K06233  low density lipoprotein-related protein 2
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:xco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    114148390 (lrp2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:xco04131]
    114148390 (lrp2)
Membrane trafficking [BR:xco04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Low-density lipoprotein receptor (LDLR) family proteins
    114148390 (lrp2)
SSDB
Motif
Pfam: Ldl_recept_a Ldl_recept_b FXa_inhibition cEGF DUF5050 EGF_CA SGL Arylesterase He_PIG
Other DBs
NCBI-GeneID: 114148390
NCBI-ProteinID: XP_027879431
LinkDB
Position
7
AA seq 4680 aa
MWRAPPLQLFFFFLCSVRWCHAEGCELGQFRCGTGRCIPEEWHCDGTSDCIDDTDEHDCP
QVTCDDSHFQCLSDGECIPDVWVCDNEEDCEDSSDERHCPGRTCTSGQFSCSNGACIPRE
YHCDHLADCLDGSDERNCNYPQCTEMRCANGACYNRTQRCDHLLDCRDGSDEANCTQHCN
TGFHQCHNGLCVPQRYVCDHDDDCGDRSDEINCTYPACRGNYFTCPSGRCIHQVWLCDGE
DDCEDNADEKGCDNVPRECYPGEWPCPSSGLCIPMDKLCDGKADCPDGEDETNTTAGHNC
SIWKCASLSCEHHCHTSPDGGTCACPSGYIVNSNDSRSCIDFDDCSMWGNCDQLCEDRIG
SHRCSCREGYTLEQHQYCRADISTGVPSLVFSNGRDLVIGDIHGNNLRTLVNSQNRGIAV
GVDFHYHLRRVFWTDTIQNKVFSVQMDGSNMQVVLNVSVDYPENLAVDWVNNKLYVVEAS
VNRIDMVDLDGSNRVTLITENLGNPRGLAVDPTVGYMFFSDWEAANGQPGLERAFMDGTN
RYGIIGSKLGWPAGITLDIEVKRIYWVDSRYDYIETATYDGLHRKTVIHGGTVVPHPFGI
SLFEHNVYFTDWTRMAVIKANKFTDSNPHVIYTTSHTPHGVAVIHQLKQPQAPNPCSLDR
GGCEQICVLSHRSDNGGLGYRCKCRIGYDLHADGKRCLAVRQFLLFSSQLAVRGIPFNLS
SQEDIILPVTGSPSYFVGVDFSAEDDAIFFSDTAKDIIYKQKVDGTGREILAANRVEGVE
DLAYDWISKNLYWTDPRYRSISVMRLADKSRRAIIQNLNNPRAIVVHPLIGYIFWTDWYR
PAKIMRAWGDGSHAMSIVNTTLGWPNGLAIDWSSMRLYWVDAFFDKIEHSNFNGQNRLSL
DRITQISHPFGLTIFEGFAYFTDWRLGGIVRVRKTDGGQMVVIRRGISHIMHVKSFNSNS
QIGANLCNRQTNPNGDCSHFCFPAPDSQRVCGCPYGMKLLPNQQTCVEDPSNEPPTMQCG
ANSFSCGNGKCVPNTYRCDGVDDCHDKTDELHCGINNITCSPLAFTCASQRCVPAGWRCD
GHNDCFDNSDEINCPTRVPGTCPANQFTCANHRCIPHTWRCDTDNDCGDGSDEADCYLGS
TCHPGQFQCPDHRCIDPNYVCDGDRDCVDGADEQGCIYNCTVSEFKCTSGHQCINSYYRC
DGVFDCSDRSDEQNCPTRPPGMCHHENEFQCQSDGSCIPSSWECDGHPDCQDGSDEHHAC
PPRTCPSSLFRCDNGNCIVHSWICDGDNDCRDMSDERDCPTPPFRCPSWQWQCPGHSVCI
NLTTVCDNTPNCPNGADESPLCNEPLPDQESCSDNNAGCTHGCIQGPFGAQCTCPVGYQL
SNDSQTCEDIDECNPPGLCSQHCFNERGSFRCHCQDGYTLEADQRTCKASDSRQAFLLVA
SRNQIIQDEISAQPNVIRSLIRDGRNVVAIDFDSESNRVYWSDTSQDRIWSSHINGSERT
VIFDSGVTVTESLAVDWVGRNLYWTDYVLETIEVSKLDGTHRTVLVSENVTNPRGLVVDP
RDSAHLMFWTDWGRNPRIERASMDGKLRTVIISSKLYWPNGLTIDYPNNLLYFADAYLDF
IDYCDYNGNNRKQVLASDLVLQHPHAITIFEDFVYWTDRYINRVMRAHKWHGENQTVMLF
NLPQPMGLVAVHPTRQPAGRNHCLGSACTHICLLSAVGPRYYSCACPSGWTLAADQFTCA
RVEDPFLVVVRDSIIYGIPLNPEDKSNDAMVPVAGLHNGYDVDFDDKEQTIYWVEHPGEI
HRVKSDGTNRTEFAPAAILGSPVGLALDWITENLYYTNPATQSIEVLKLRGDVQYRKTII
TNNGSPTGAGSPVGIAVDPARGKLYWTDQGTESGIPAKVAAADMDGMNPVTLFTNNLDHI
EFLTVDIQENKLYWAVTGTGKIERGDPDGSNRITLVMGLSHPWGVAVYQNYLFFSDRDFE
VIERVDKSTGANRVVMRDNLSGLRVLKVHFRDTSAGTSNGCTDNMGACEQLCLPRPQGFF
TCACATGFKLNADNRTCAHYKSYVVISTLSAIKGFSLEGSDHSEAMVPVAGRGRNALHVD
VHMASGFIYWCDFSSTVMIQNGVRRIKPDGSGLHSVVTSGIGRNGIRGIAVDWAAGNLYF
TNAFLTETYVEVLRLNTTFRKVLLKTQVDMPRHLVVDPRNRYLYWADYGQHPKIERALLD
GTNRTILVSSGIITPRGLALDWHTGYVYWVDDSLDMIARIGPHGGETEIIRYGSRYPTPY
GITVFENSIIWVDRNLKKVFQASKEPGRTEQPAVIRDNINMLRDVTIFDQRTQPTSVQEL
NYNPCMENNGGCGHFCFALPGSSQGTQNKKCSCAFGDLATDKESCEMSKEDYLIYTTEST
VRSLRLDPEDHALPFPVVNVPRTSIALDFDLTDNRLYFTQSSGAGASKISYISLSSPTTA
PVVVAADLGAPDGIAYDWINKRIYYSDYVNQSISSMSVDGAQKTIIAHVSRPRAIMLDPC
RGYMYWTDWGTHAKIERATLGGNFRTDIVNSSLVWPNGLTLDYEEERLYWADASLQKIER
SSLSGANREVIVSTAIYPFAMTMFGQFIYWTDWNTRSIYRANKHDGSDQRVMIQNLPSRP
MDIQVLARRKQQRCDSPCQQFNGGCSHICTPGPNGPECQCPAEGRWYLADSKYCIPDNGT
RCQPGQFTCMNGRCIRPQWICDNDNDCGDGSDELERVCGDKPIFSYAVPQLLSSFIALSA
FHTCEPTVLTCGNGRCVPYHYRCDHYDDCGDNSDEVGCLFRPCDPSTEFACNNGRCIAKD
YVCNGINNCYDNGTTDEQNCTERTCQPEETKCQSTNICIPRSYLCDGDNDCGDMSDESPT
HCAAATCSQSEFRCSSGRCIPAHWYCDGGADCSDGSDEPLSCTTLVRTCNTDQFRCDDGR
CIALSWICDGDNDCGDMSDEDQRHNCANRTCSSTEFTCVNNQPPQRKCIPRDWVCDGDAD
CADALDEHQNCTRRSCGINEFTCSNGLCIRSSYRCDRRNDCGDSSDEQGCTYHPCQSHQF
TCQNGRCVSNDFVCDGDNDCGDESDELQHMCHTPEPTCPPGEFRCENGHCIPFRKVCDRN
DDCSDNSDEKGCGLNECTDPSIHHCDHNCTDTPTSFICTCRPGYRLMSDGKTCDDVNECA
ETPSVCSQICENTVGSYVCKCSPGFLREPDGRSCRQNSNISPYLIFSNRYYLRNLSTDGQ
AYSLILQGLTSVVALDFDRVDKRLYWIDVSRRVIERMSFNGSNREVVVNGVLHGEGLAVD
WIGRKLYWVDSFLDCLKVSELDGRFVKKLAEHCVDGNNTYCFENPRGIVLHPKYGYVYWT
DWGNKAFIGRVGMDGTNKAAIITTKIEWPNGITIDYTNDKLYWSDAHLNYIEYSDLDGQH
RHTVYDGNLPHPFALTVFEDTVYWTDWNTRTVEKSNKYDGSGREALVNTTHRPFDIHVCH
PYRQPIVNNPCAANNGGCSHLCLIRHGGREHTCDCPDHFLAVQIGGVTRCLPMCTSTQYR
CANNERCIPIWWKCDGQRDCRDSSDEPSTCPIRHCSLGQFQCNDGNCTSSHFLCNSHRDC
PDGSDEDAVLCATHQCESHQWQCTNKLCISESWQCDSEDDCGDQSDEDPVHCATRTCRPG
QFKCRNGRCIPQSWKCDVDDDCGDNSDEPLEECMGPAYRCDNHTEFACKTNYRCVPLWSI
CNGHNDCRDNSDEQSCEEVTCDPTGDFHCDNHRCIPLRWRCDGADDCGDNSDERSCTPRS
CTESEYRCDNLRCVPNRWVCDHDNDCEDNSDERDCELRTCPPGYFQCASGHCIAERFKCD
GNADCLDYTDETSCPTRFPNGTYCPPFLFECRNHICVQPHWKCDGDNDCGDNSDEELHLC
LDIECEAPFRFRCDNNRCIYSPELCNSIDDCGDGSDERQENCQKPTHGPCDDEEFKCSNG
KCIPLQYACDEYDDCGDESDELGCHVGHGHTCSANMCEHNCTDLTQGGFVCSCRPGYKPR
ATEKHTCEDVNECEVFGTCPQDCRNSKGSYECFCAEGFVSFGELHGTECAAQGNPPVLLL
PDNIRIRRFNLSSEQYSDYVDNAEHIHALDYLWDPEGEGLSVVYWTVLGRGSQFGSIKRA
YMTTFNDYGSNPVKEVDLNLRYIAKPEGIAVDWVGRHIYWTDSGTNRIEVAKLDGRYRKW
LVHTDLHQPAAIIVNPSSGMMYWTDWGQNPKIEAAWMDGQHREVLVKEEDLGWPTGLALD
YVNGNRIYWCDSKENIIESMKPDGTDRKIVISGDIGNPYSLDVFEGNVYWTTKDKGEVWK
TNKFGQGNKVKVLTINPWLTQVRIYQQYRHNQSVSNPCKNVCSHLCLLRPGGYTCACPQG
SPPLNADSTECDAAIEAPVAMPLACRCMNGGTCYTDEGGLPKCKCPYGYTGSYCQMGKSR
GAPAGTAVAVLLTVIVILITGALAAGVFLNYKRTGSFIPSMPKLPSLSSLVKSADTGNGV
TFWSGDNVDLGPSHIGVSVIDTAMQMDDNFATNAGRQPVTFENPLYTTTPVSGDPAVIHA
TQVRVNVSGEQLNNFVNPTYRGDQSSGVINTSSVCSLPVQMSKWSLFKRKLKPSTTFENP
SYSEMKDEKPGGSSEDTSTPEPSPFVPPPKPPKKDRPSTFSPTEDSFKDTANLVKEDSDV
NT seq 14043 nt   +upstreamnt  +downstreamnt
atgtggagagcaccgccgcttcaactctttttcttctttttatgctctgttagatggtgc
catgctgaaggatgtgaattagggcagtttcggtgtgggacaggtcgatgtatacctgag
gagtggcactgtgatgggacatcagattgcattgatgacactgatgaacacgactgccct
caggtaacatgcgatgacagtcatttccagtgtctgagtgacggcgagtgcatcccagat
gtatgggtgtgtgacaatgaggaagactgtgaggatagctcagatgagagacactgccct
ggcaggacatgcaccagtggccagtttagctgcagtaacggggcatgcatcccgagagaa
taccattgcgaccacctggctgactgcttagacggatctgatgagagaaactgcaattac
cctcagtgtacagagatgaggtgtgccaatggggcctgctacaaccggacccaacgatgt
gaccatttactggactgccgagatggctctgatgaggcaaactgcacacagcactgcaac
acagggttccaccaatgccataatgggctatgtgttcctcaacgctacgtctgtgatcac
gacgatgactgcggagaccggagtgatgaaataaactgcacgtatcctgcttgcagagga
aattacttcacttgtcccagcggccgctgtattcaccaagtctggctttgtgatggagag
gatgactgtgaggacaatgctgatgaaaaaggctgtgataatgtaccacgggagtgttac
ccaggagagtggccctgtccttcgtctgggctgtgcatccctatggataagctgtgtgat
gggaaggctgactgtcctgatggagaggatgaaactaacaccactgctggacacaactgc
agcatctggaagtgtgcttctttgagctgtgagcatcactgccacacttcccctgatgga
ggaacatgtgcctgtccttctggctatattgtcaacagcaacgacagtcgctcctgcata
gactttgatgactgctccatgtggggcaactgtgatcagctgtgtgaggaccggatcggc
tcccatcgctgcagctgtagagagggctacactttggagcaacatcaatactgtagagca
gacatatccactggagttccttccttagttttctctaatggcagagatctggtaataggc
gacatccatggcaacaacctgcgcactttggttaattcacagaacagagggattgctgta
ggagtggacttccactatcatctccgtagggtcttctggacagataccatccaaaataag
gtgttttctgtgcaaatggatgggtccaacatgcaggtggttttaaatgtatcagttgac
taccctgagaacctggcggtggactgggtgaacaataaactgtatgtggtggaggccagc
gtcaacaggattgacatggtggacctagatggaagtaaccgggttacactcatcactgaa
aacctcggaaaccctagaggactggcggtggaccccactgtcgggtacatgtttttctca
gactgggaggcagcaaacggacagccaggtcttgagcgggccttcatggatggtaccaat
cgctatgggattattgggagcaaactaggttggcctgctggtatcacactcgatatagaa
gtcaagcgcatctactgggttgacagccgctatgattatatcgaaactgcaacctatgac
ggtctgcatagaaaaactgtaatccatggggggaccgtggtaccacatcctttcggaatc
agcttgtttgagcacaatgtttatttcacggactggaccaggatggccgtgataaaagca
aacaagtttactgacagtaacccacatgtgatttacaccacgtctcacaccccacatgga
gtagcagtgatacatcagttaaagcaaccacaagcgccaaacccttgcagtttggacaga
ggtggatgtgagcagatatgtgttctcagtcacaggagcgacaatggaggacttggttat
cgctgcaaatgtcgcattggttatgaccttcatgctgatggtaaacgctgtttggctgtg
aggcagtttctgcttttctccagccagctggctgtgagaggaatcccctttaacctctcc
tcccaggaggacatcatcctgcccgtcaccggatcgccctcctactttgtcggagtggat
tttagcgctgaagatgatgctatctttttctctgacacagcaaaagatattatttacaaa
cagaaggtggatggaacaggcagggagatactggcagccaacagagtggagggagtggag
gatctggcttacgactggatttccaaaaacctctactggacggaccctcgatacaggagc
atatctgtcatgaggctcgctgataagtccaggagggccattattcagaacctgaacaac
cccagggccatcgtggtgcatcctctgattgggtatattttttggactgattggtaccgt
cctgcaaagattatgagggcttggggtgacgggtcacatgccatgtctattgtaaacact
accctgggctggccaaatggattagcaattgactggagctcaatgcgtctgtattgggta
gatgccttctttgacaagattgagcacagcaactttaacggacaaaacaggctttccttg
gaccgcataacccagatctcccatccttttggccttaccatttttgaaggctttgcgtat
ttcactgactggcgcctgggtggcattgtccgtgtgcgcaagactgatggtgggcagatg
gtagttattaggagaggaatcagccacatcatgcatgtcaagtctttcaactccaactct
cagatcggtgctaacctctgcaacaggcagacaaatcctaacggcgactgcagccacttc
tgcttcccagctccagactctcagagagtgtgtggctgcccgtacggcatgaagctgttg
ccaaaccagcagacgtgtgtcgaggacccctccaacgagcccccaacaatgcagtgtgga
gccaactccttctcctgtggcaatggcaaatgtgtcccaaacacctacagatgtgatggt
gttgatgattgccatgacaagactgacgaactccattgtggaataaacaacattacttgt
tcccccttggccttcacctgtgccagtcagcgctgcgtgccagcagggtggcgctgcgac
gggcacaatgattgctttgataacagcgacgagatcaactgccccacacgggtgccagga
acgtgccccgccaatcagttcacatgcgccaaccaccgatgcatcccgcatacgtggcgc
tgcgatacagataacgactgtggagacgggtccgatgaagcagactgctacctgggtagt
acatgccacccaggacagtttcagtgtcctgaccaccgatgtatagaccccaactatgtc
tgtgacggagacagagactgtgtggacggagcagatgagcagggatgcatctacaactgc
actgtgagtgagttcaagtgtaccagcggccaccagtgcatcaactcctactaccgctgc
gatggggtcttcgattgtagcgatcgctctgacgagcaaaactgtcctaccaggccccca
gggatgtgccatcacgagaatgagtttcaatgtcagtcagatgggagctgtatcccgtcg
tcatgggaatgtgatggccatccagactgtcaggatggcagcgatgaacaccacgcctgt
cctccccggacctgcccatcttctctcttccgctgtgataatggaaactgcatcgtacac
agttggatttgtgacggagacaacgactgcagagacatgagcgatgaaagagattgtccc
acgccgcctttccggtgtccaagttggcagtggcagtgtcctggtcacagtgtttgtatc
aatctcaccacagtgtgtgacaacacacccaactgtcccaatggcgctgatgagtctccg
ctttgcaatgagcctttaccagaccaagagagctgttctgataacaacgctggctgcact
catggttgtatacaggggccttttggggcccagtgcacatgccctgttggttatcagctc
agcaatgactcccaaacgtgtgaggatatagacgagtgtaatcccccaggactgtgtagc
cagcactgctttaatgagagaggctcctttcgctgccactgccaggatggctacactctt
gaagcagaccaacgtacctgcaaggcttcagattctcgtcaagcctttctacttgtggcc
agccgaaaccagattatccaagatgaaataagcgctcaaccgaatgtgattcggtcactg
atccgagacggacgcaacgttgtggctatagattttgactctgagtcaaaccgtgtgtac
tggtccgatacaagccaggacaggatctggagttctcacataaatggcagtgagagaact
gtgatatttgacagtggagtgactgtgacagagagccttgcagtggattgggtgggcagg
aatttatactggaccgactatgtcctggagacaattgaggtgtctaaactggacggcaca
caccggaccgtcttagttagtgaaaatgtcaccaaccctcgaggtctcgtggtggatccc
agagacagcgctcacctgatgttttggactgactggggaaggaacccccgcatagagagg
gcaagcatggatgggaaactcaggacagtcatcataagcagcaaactgtactggcccaat
ggtttaaccatcgactatccaaataatttgctgtactttgctgatgcctatttagacttc
attgattactgcgactacaatggcaacaacagaaaacaagtccttgccagcgacttggta
ctgcaacatccccacgcaattaccatttttgaggattttgtctattggaccgacagatac
atcaaccgagtgatgcgagctcataagtggcatggggagaaccagacagtgatgctgttc
aacctccctcagccaatgggtctagtggcagtgcacccaaccaggcaaccagcagggaga
aatcactgcttggggagcgcctgcactcatatctgcctactctctgctgtgggaccaaga
tactattcatgtgcctgcccctccggctggactctggcagcggaccagttcacctgtgcc
agagttgaggatccttttctggtggttgtgagagacagcatcatctatggtattccacta
aacccagaggacaagagcaatgatgcaatggttccagtagctggtcttcacaacggctac
gatgttgactttgatgacaaggaacagaccatctactgggtggaacaccctggtgagatc
cacagggtgaagtcagacggtacaaacaggacggagtttgcccccgcagccattctcggc
tctcctgttggcctggccctggactggatcacagagaatctgtactacaccaatccagct
acacagtctattgaggttttaaagttgagaggagatgtacagtaccggaaaactataatc
acaaacaacggctctccgaccggcgctggcagtcctgttggcatcgctgtggatccagca
cgtggcaaactttactggacagaccagggaacagaaagtggcatccctgccaaggtggca
gctgcagacatggatggcatgaacccggtcacgctcttcaccaacaaccttgatcacatt
gagttcctcactgtggacatccaagagaacaagctgtactgggctgtcaccggcactggg
aaaattgagcgaggggatccagatggaagtaaccgcatcaccttagtgatgggtctctcc
cacccttggggtgtggccgtctaccagaactacctattcttcagcgatcgtgactttgag
gtcatcgagcgagtagacaagtccactggtgccaacagggttgtgatgcgagacaacctg
tcaggacttagagtcctaaaagttcactttagagatacatctgcaggtacatctaatggc
tgcaccgacaatatgggagcgtgtgagcagctctgtcttcctcgaccacaagggtttttt
acctgtgcatgtgcgacaggttttaaactaaatgcagacaaccggacttgtgcccattac
aagtcctatgttgtcatctccactctatctgctataaaaggcttcagtcttgaaggctca
gatcactctgaggcaatggtccctgtggctggaagaggtcgcaacgctctccacgtcgat
gtgcacatggcttctggtttcatttactggtgcgacttcagcagcactgtgatgatacaa
aacggggttagacgtataaagccagatggctcaggattacacagtgtggtcacatctgga
ataggacgcaacgggatacgaggcattgctgtggactgggctgcaggtaacctgtatttc
accaacgcctttctgactgagacgtatgtcgaggttcttcgtttgaacacgactttccgg
aaagtactgctgaagacgcaggtggatatgccacggcaccttgttgtggatcccagaaac
agatacctgtactgggctgattatggtcagcaccccaaaattgagcgtgcactcttggat
ggaaccaaccgcacaattttagtgtcttcagggataatcaccccacgaggccttgctctg
gactggcatactggatatgtctactgggtggatgactctctggatatgatagctcgcata
ggccctcatggaggagagacagagatcattaggtacggcagccgctatccaactccttac
ggaatcacagtgtttgagaacagcatcatttgggtggacagaaacctcaaaaaagttttt
caagcaagcaaagagccaggcaggacagagcaaccggctgtaattagagataacataaac
atgctgagggatgttactatctttgaccaacgtacacaacccaccagtgtgcaggaactg
aactacaacccctgcatggaaaacaatggtggctgtggccacttctgctttgcccttcca
ggctctagtcagggcactcaaaataaaaagtgcagctgtgcttttggtgatcttgccaca
gataaagagagctgtgagatgtcaaaggaggattacctcatctacactactgagagcaca
gtccgcagtctgagacttgatcctgaggaccatgcgctgccatttcctgttgtcaatgtg
cctcgcacctccattgctcttgattttgaccttacagacaacaggctttacttcactcag
agctcaggtgcaggagccagcaagatcagctatatcagcctgtcctctcccactacagct
cctgttgtagtagctgcagatcttggggctcctgacgggatagcctatgactggataaac
aaaagaatttactatagcgactatgtcaaccagagcattagctcgatgtctgtggatggt
gcccaaaaaacaataattgcccatgtgtcgaggccaagggccatcatgttggacccctgc
aggggatacatgtactggacagactggggaactcatgcaaagattgagcgagccaccttg
ggaggaaatttcagaactgatattgtgaacagcagtctggtgtggccaaacggtctgact
ttggactatgaagaggagagactctactgggcagatgcaagcttacagaagattgagcga
tcctctctatctggggccaaccgcgaggtcattgtcagcacagccatctacccgtttgca
atgactatgtttggtcagttcatctattggaccgactggaacacccgcagcatctatcgg
gcaaacaaacacgatggctctgaccagagggtcatgattcagaacctcccatcccgacca
atggacattcaggttctggcccgcaggaagcaacaacggtgcgacagtccctgtcagcag
ttcaacggaggctgcagccacatctgcactccaggacctaatggacctgagtgtcagtgc
ccagcagaaggtcgatggtacctggctgacagcaagtattgtattcctgacaacgggact
cgctgccagccaggccagttcacctgcatgaatggccggtgtatccgaccccagtggata
tgcgacaatgacaatgactgtggagatggcagcgacgagctggaaagagtatgtggagat
aaaccgatcttcagctatgctgtcccacagctgctctcttcctttattgcactgtcagcc
tttcacacctgcgagcccaccgtgttaacttgtggcaatgggcggtgcgttccctatcac
taccgctgtgaccattacgatgactgtggagacaacagcgatgaagttggctgtctgttc
agaccctgtgaccccagtacagagtttgcctgcaacaatggccgctgcattgcaaaggac
tatgtttgcaacggcatcaacaactgctacgacaatgggactactgatgagcaaaactgc
actgagagaacctgccagccagaggaaacaaagtgtcagtctacaaacatttgcatccca
cggtcatacctatgtgatggagacaatgactgtggggatatgagtgacgaaagcccaaca
cactgtgctgcagccacttgctcccagagcgagtttcgttgttccagcggtcgctgcatc
cccgcccactggtactgtgacggaggagctgactgctctgacggctctgatgaacccctc
tcctgcaccacactggtcagaacctgcaatacagatcagtttcgctgtgatgatggcagg
tgcattgctttatcatggatctgtgatggagacaatgactgtggtgacatgagcgatgaa
gatcagagacacaactgtgccaatcgcacgtgttcaagcacagagttcacttgtgtcaat
aaccaaccacctcaacggaagtgtattccacgtgactgggtgtgtgatggagatgcagac
tgtgcagatgccctagatgaacatcaaaactgcacccgcagatcctgtggcatcaatgag
ttcacctgcagcaatggtctctgcatacgcagctcctacagatgtgaccgtcgtaatgac
tgtggagacagcagtgatgagcaggggtgcacttaccatccctgccagtcacaccagttc
acatgccagaatggccgctgtgtctctaacgactttgtctgcgatggagacaatgactgt
ggggacgagtctgatgagctgcagcatatgtgccatacacctgagcccacctgtcccccc
ggagaattcagatgtgaaaatggacattgtattccctttaggaaagtgtgtgataggaat
gatgactgctccgacaacagtgacgaaaagggatgtggtctcaatgagtgtacagaccca
tccattcaccactgcgaccacaattgcactgatacacccaccagcttcatctgcacctgc
cgtccaggttaccgcctcatgtctgacggcaaaacatgcgatgatgtcaacgagtgtgca
gagacacccagtgtttgcagtcagatctgtgaaaacactgtcggctcctacgtgtgcaag
tgctctccgggatttctcagagagccggacggacgcagctgccgtcagaacagcaacatc
tctccctacctcatcttcagcaaccgctattacctgaggaacctgtcgacagacggacag
gcctattctcttattctgcagggcctgaccagcgtggtcgcactagactttgaccgtgtt
gacaaacgtctctattggatcgatgtgagtcgcagagtgatagagaggatgtcttttaac
ggcagcaaccgggaggtggtggtcaatggagttctgcatggagagggcctggcggttgac
tggataggaaggaaactgtattgggtggacagcttcctggattgtctcaaagtgtccgaa
ctggacggtcgttttgtcaagaaactggctgaacattgtgttgatgggaataacacctac
tgctttgaaaaccccaggggtattgttctgcatcccaaatatggatatgtctactggaca
gactggggaaacaaagccttcattggtcgtgttgggatggatggaaccaacaaagcagca
atcatcaccaccaagatagagtggcccaacggcatcacaatcgactacaccaacgataaa
ctctactggtcagatgcgcatctcaactacattgaatactccgacttggatggtcagcat
agacacacggtgtatgatggaaacttgccgcacccttttgccctgactgtttttgaagac
actgtgtactggactgactggaacacacgcactgtggagaaaagcaacaagtacgatggt
tctggtcgagaagccctggttaacaccacacacaggccattcgacattcacgtatgccat
ccttaccgccagccgattgtaaacaatccctgtgctgcgaacaatgggggctgctctcac
ctgtgcctaatccgtcacggggggcgagaacacacctgtgactgccccgaccatttcctg
gctgttcaaataggaggtgtgacccgatgcctgcccatgtgcaccagcacccagtataga
tgcgcaaacaatgaacgttgcatccctatctggtggaaatgcgacggtcagcgggactgc
agggacagctcagatgagccctctacctgccctattcgccattgcagcctcggccagttt
cagtgcaacgatggaaactgtaccagttcacactttctgtgtaacagccaccgggactgt
cctgatggctcggatgaagatgccgtgctgtgtgctacacaccagtgtgaaagccatcag
tggcagtgtacgaataagctttgcataagcgagtcttggcagtgcgacagtgaggatgac
tgtggcgatcagtcagacgaggaccctgtccactgtgccaccaggacctgtcgcccggga
cagttcaagtgccgcaacggacgctgcatcccacagagctggaaatgtgatgttgatgat
gattgcggtgacaattcagatgagcctctggaggagtgcatgggtccagcttatcgatgt
gacaaccacacagaatttgcctgcaaaaccaactatcgctgtgtcccactctggtccatc
tgcaatggccacaacgactgcagagacaacagcgacgagcagagctgtgaggaagtgacc
tgcgatcctaccggggatttccactgcgataatcatcgctgcatcccgctgagatggagg
tgtgatggagctgacgactgtggagataattcagacgaacgcagctgcacgccacgctcg
tgcaccgagagcgagtatcgctgtgacaacctgcgctgtgttcccaaccgttgggtctgt
gaccatgacaacgactgcgaggacaactcggatgaaagggactgcgagctgcggacgtgt
ccccctggctacttccagtgcgcgagtggacactgtatagctgaacgtttcaaatgtgat
ggcaacgccgactgtctggactacacggatgagacatcatgcccaacccgctttcccaac
ggcacctactgcccgcctttcctgtttgaatgcaggaaccacatttgtgtccagcctcac
tggaaatgtgacggagacaatgactgtggagacaattctgacgaggagctgcatctttgc
ttggacatcgagtgtgaggctccattccgtttccgatgtgataacaaccgatgcatctac
agccctgagctgtgcaactctattgatgactgtggggacggttcagatgaaagacaggaa
aactgtcaaaagcccacacacggtccttgtgatgatgaggagttcaaatgcagtaacgga
aagtgcatccctctacagtacgcctgcgatgaatatgacgactgtggtgacgagtcagat
gaacttggctgccatgtgggccatggacacacatgcagtgcaaacatgtgtgaacacaac
tgcaccgacctgactcagggaggctttgtttgctcctgcagacccggttacaagcccaga
gccacagagaaacacacctgtgaagatgtgaatgagtgtgaggtatttggaacatgccct
caggactgcaggaactcaaaaggcagctacgaatgtttctgtgctgaaggctttgtgtct
tttggtgaactgcatggaactgaatgcgctgcgcaaggaaatcctccagtcctgctcttg
ccggacaacattcgtattcgacgtttcaatctgtcctctgagcagtattcggactatgtg
gacaatgccgagcacattcatgccttggattacctgtgggatccagagggcgaaggccta
agtgttgtttactggacagttcttggtcggggttcccagtttggctccatcaagcgggcc
tacatgaccacattcaatgattatgggagcaacccggtgaaagaagtggatctgaacctg
cggtacattgccaaaccggagggcatcgctgtagactgggttggcagacatatttactgg
acggattcagggaccaacagaattgaagtggcgaaactggatggacgatacaggaagtgg
ctggtccacactgaccttcatcagccggcagctatcattgtcaacccgtcatcagggatg
atgtactggactgactgggggcagaatcccaaaattgaggcagcatggatggatggacag
cacagagaggtcctggtaaaggaggaagacctgggatggcccactgggctggctctagac
tacgtgaatggaaacagaatctactggtgtgactccaaagaaaacattatcgagtccatg
aagcctgatgggacagacaggaagattgtcatatcaggagatatcggaaatccctacagt
ctggatgtctttgagggaaatgtgtactggacaactaaagacaaaggagaagtgtggaag
acgaataagtttgggcaaggaaataaagtcaaggtccttacgatcaacccctggctgaca
caagtccgtatttaccagcagtaccggcacaaccagtcagtgtccaacccatgtaagaac
gtgtgcagtcacctctgcctcctccggcctgggggctacacctgtgcctgcccacaaggc
tcccctccactaaatgctgactcaacagaatgcgacgcagccattgaggctcctgttgca
atgcctcttgcatgcagatgcatgaatggtggaacctgctacaccgatgaagggggtctg
ccaaagtgcaaatgtccatatggctatactggcagctactgtcagatggggaagtctaga
ggtgcaccagctggtacagccgtggctgttctgctgaccgtcattgtcatcttaattacc
ggagctctagctgctggggttttcctcaactacaaacgaacaggatcttttatcccctct
atgcctaaactaccaagcctcagcagtcttgtgaagtcagctgacaccgggaatggggta
acgttttggtcgggtgataatgtggacctcggaccgtcacacatcggtgtttctgttatc
gacacagccatgcagatggatgataactttgccaccaatgccgggcgacagccagtcaca
tttgagaatccactgtacaccactacacctgtctctggtgatccagccgtcattcatgct
acacaggtgagagtcaatgtgagtggtgaacagctgaacaactttgtgaacccgacgtac
cgaggagatcagagctcaggtgttatcaacacatcttctgtctgcagccttcctgttcag
atgtcaaagtggagcttgtttaaacggaaattaaaaccaagcaccacatttgaaaaccct
tcatattcagagatgaaggatgagaaacctggcggaagcagcgaggacacttctacccca
gagccgtctccattcgttcctccaccaaaacctccgaagaaggatcgtcccagcaccttc
tctccaaccgaggacagtttcaaagacacggccaaccttgttaaagaggacagcgacgta
taa

KEGG   Xiphophorus couchianus (Monterrey platyfish): 114149015
Entry
114149015         CDS       T05908                                 

Definition
(RefSeq) low-density lipoprotein receptor-related protein 2-like
  KO
K06233  low density lipoprotein-related protein 2
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:xco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    114149015
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:xco04131]
    114149015
Membrane trafficking [BR:xco04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Low-density lipoprotein receptor (LDLR) family proteins
    114149015
SSDB
Motif
Pfam: Ldl_recept_a Ldl_recept_b FXa_inhibition EGF_CA cEGF PRKCSH-like
Other DBs
NCBI-GeneID: 114149015
NCBI-ProteinID: XP_027880357
LinkDB
Position
8
AA seq 3509 aa
MDLRLVVCFIFLPNLRFSSGQLLSCPEGQWQCDDGTCITDVWRCDGEGDCLDGSDEMDCN
ASTNLDCPAGQFPCMDSVGCVDMSAHCDGQKQCPTGSDEENCPATEGCLDSEWMCGNHIC
IPKELHCNGQNDCMDNSDEEDCGKCSENGLQCPEGKCLFAEERCDGHIHCSDGSDEPITC
GRTCSMYNGSCSHICADESWGVRCICPVGHKLSPNGAVCEDLDECASSVPRCAHHCTNTI
GSYYCHCREGFILNGHSTCQALGNATQLLMMQRNSIGLLNVKSKQFTAIKAPVSDPVAST
YDITRGWYYWADGSGSIYKTNGRNTWATFTGPPGIKGLACDWLNGYLFWTNKKTESIYMQ
SSDDKSFTALLSKNVSPSELVLLPIERFMFWINEGLGDRVTLERSWMDGSDRSTLVVLTA
QFAHSLTADVAARRLYWISDSKRSVETVKTDGTGRYSFTGLFSKRPAFSLAVFESMFFWV
DQKGLWQAPQDQSNPKKFIRKTDLPLLSVFHELQQPKGSSPCAKTHCLLCQLTKNNPAGF
TCACPYFKVLLPDGTCKYPRFLYGTVTTISLLEFKGKESSETELFSSKEGILSFDVDWFR
EWLYWANQTGHVQRTKLTLDKTEFISTPLPVCLLSVDQRSGNLFWVSCDQNIIGTSAASR
NYPQQLYHTTKEISSFYLDWLRGGMFWLEEDRIFGMGMMGEKAKELLQMAGGVRGNVAFD
LRASSLLWNSKRGGLTTLSLLKEKSHQAGRRWNVSGSVVAAFEPFLLSISNKVITLWDRR
DGSKIQSVSVKGPVLSIITVLGDIQTVPDTQVCNVPSWLCHQSSICLPQNLLCDGKRDCP
GGDDEELCVSACPQEDFMCMDRRNCIPRILLCDGRAHCHDGSDEVDCPTVAAPLSRTNVL
KCRSGSVLCQDGTECVLYTHVCDGEADCKDGSDELGCDATQEPTSSTKPNKKLPVTKAPP
FILSACLSPSVLCPSFKAYICISQSQFCDGIKDCPDGFDEQDCAERCRLRSDFLCKNHQS
CVPKSSVCDGRPDCLDGSDEVGCPNVAQGVPHNGLKCRFGSKRCRDGLSCVLMSHICDGE
RDCRDGSDEDGCDTAGIATIAPTTPPCTSPSVLCPGSSRCIKPTQMCDGQRDCPDGSDEK
CVKRCSYESDFHCKDRRSCVPLSQVCDGRAQCNDGSDELNCPSEAPPAAPNKSLKCHFGS
KLCQDGLRCVLLSHICDGERDCQDGSDEDRCDSAVENGPLIGAPTPTKEVIQPPTMPPCT
SPSVLCPGSTICIKHTQMCDGKRDCPDGSDEKCVKRCTSDAHFRCKDRRRCIPKSQVCDG
RSQCTDGSDEVNCLSAVVQEAPKEVLKCRFGSKLCNDRTACVLLSHICDGEVDCQDGSDE
EACDSESAPGNSMGNGLLSKSPELTKKVTLPPTKPPCTSPSVLCPGSSICIQHTQVCDGK
EDCPDGSDEKCIERCPSERDFLCRDRRHCIPKTQVCDGRSHCNDGSDEISCQSLVQPASP
TKILKCRFGSKLCRDGTSCVLPSHICDGEPDCQDGSDEEECDESLTQSPTPTKEVTQILT
KPPCTSPSVLCPGSSVCIKTTQMCDGTWDCPDGYDEKCVERCPSNYFHCKDRRSCIPRTQ
VCDGRSQCNDGSDEVNCQSAAPPAASTKVLKCRFGSKLCDDGTSCVLLSHFCDGDADCHD
GSDEEGCDNGSLNQSPTPTKEVALIPTNPPCTSPSVVCPGSSICIKPTQMCDGTRDCPDG
FDEKCVNRCPSDTDFRCNDRRRCIPKTKVCDGRSQCDDGSDEMNCHNGEVAPKAPSKVPK
CRFGSKLCRDRMKCVLLSHVCDGETDCQDGSDEEGCDATETDAQSSVDNDYMNESPKPVK
RFSQPTTSPPCTSPSVLCPGTSICLKATQICDRRKDCPDGSDEKCVRRCPGTDFRCKDRR
SCVPKSQVCDGRSQCNDGSDEVNCRSVESRPSQPNALKCRMGSRMCRDGTNCVLFSHVCD
GERDCRDGSDEEGCDAAETIESSSPNKRFCSFPSVLCPDSNVCINPSQLCDGIRDCPDGS
DENCVKKCADKTDFLCKDRRSCVSRSLVCDGRAHCYDGSDEADCRSVTAPPLKSNVLKCR
MGSKPCKDGKDCVLFSHVCDGEIDCMDGSDEEGCQETCDEGEFQCAHGKMCIPENEVCDG
KPQCRDHSDEMDCWQRTKSCEHRCADGKRCIPKKFLCDGEPDCLDGTDELNCDSVPTDFP
ITSTSACITPSVLCPGSSRCISQHQLCDGQRDCPDGFDEKECIVQCENPADFLCKDQRKC
IPKTQVCDGRNNCPDGSDEKQCQSELTSASSINAPRTRHRPLKCRTGFKLCKNGLECIMY
SHVCDGERDCQDGSDEEGCEKQCKPGQFQCSHGRRCIQQEQVCDGQNDCQDHSDETDCSK
PIEGCHHLCDNKTRCVPKTFLCDGEKDCTDGSDEDKCGSVACAPHQHRCESGQCISEAFK
CDGYPDCHDHSDEAGCPRAPRCPAQLQCPHSHECLQKEWLCDGEEDCKDGSDENNCNNPP
TKCRKYQFQCRGSGLCIPQSWRCDGKEDCDNGVDEDKCTQRKCPYHLYQCGSKECLETRL
VCNGINNCIDGSDEGVGCAQRNCSSPSAPTCDHRCVSTPNGPRCYCGVGFRLQSSSKSCM
DIDECTSTAATSCSHLCQNTQGSYSCLCHPGFYLEPDNKSCKTKDEPLLLASVQSEMLIL
GVHSGTLQLLSSADRPVFALDFHWAEQRVYWQSPDHQSIRWADMKSKTKGTLTKGVKSDS
IAVDWVGKNLYWVDGLVGQILAIKLSSSIMKSQDYTVVLGENLEQTSSLVLIPDKGLMLW
SEIGSIPQIEQSGMDGSQRKVLVSQDLSWPVSLAYDFLDDRIYWADEKLHCIGSASLDGD
NIKILQLTETPSPFSVAVFSDRMFWSDTKRRTVRSADKKTGKNQTVLLKRPGQPFGLKLM
HALSQPPVSSPCDHLRCSNLCLLAPAPGKSRAGAPAVNAAVCRCPKGLLLSQDRMTCVLP
KESSFILLLSHNKISQIYLRSMRRHGIALKKMPNGRDFNLPGVPEAMSLDISFSELLVFV
AYLRHGSVDVLKLTNSLSKPELVLAGQIIKLQDDSVTALAVDWVTSNLYWSSMKRPDIHV
TSRLENHTTSLLQGPLIGVASITLHPSSGRLCYFAIVIMGSRSQTEIHCAWMDGRNKVVL
WKRLSIPISMVFTNDGTRIYWADTGEGIIGSIGVDGSAYREYKTGPNLLVSFTLIENFFF
WVTQDKDVSKLWFSDGLQPKQLWFQTKTKISEIRSYNNETQSGSNHCSNSNGGCVHLCLP
YPGGRTCRCAWGFYSVNDTSCVPLPSCPSGEESCLDGSQCIGSKKFCDGRADCPDQSDEQ
DCPGSASFGTVVGGDQSPQSSLHQPDTQKNTIVPNEVLASCDLQRCNGHGNCITEGEVTR
CHCLQGYMGEFCQTQQRQSHPAIILVSICLVSAVVVGALVFTKRRWEYMRNTSADKENLM
TNMVIPGEQDSDSEELESPVDVKNPLPIK
NT seq 10530 nt   +upstreamnt  +downstreamnt
atggacctgcgcttggtcgtttgcttcatttttctgccgaatctaagattttcctcgggc
caactattgtcttgccctgagggtcagtggcagtgtgatgatggaacctgcattactgat
gtgtggagatgtgatggagaaggagactgtctggatggatcagatgaaatggactgtaat
gcctccacaaacttggattgtccagctggtcagtttccatgcatggactctgttggctgc
gtagacatgtcagcccattgtgatggacagaagcagtgtcccactggttctgatgaggag
aactgtccagccacagaaggctgcctggattctgagtggatgtgtggaaaccacatctgc
atccccaaagaactgcactgcaatggacaaaacgactgcatggacaattctgatgaagaa
gactgtggtaaatgtagtgagaatggccttcagtgtcctgagggaaagtgtctgtttgct
gaggaaaggtgtgatggacacattcactgttctgacggcagtgatgagcccataacctgc
ggtcgtacctgctctatgtacaatggcagctgcagccatatatgcgcagatgaatcctgg
ggagttcgatgcatttgtcctgttggacacaagctgtcccctaatggagccgtctgtgaa
gacttggatgagtgtgcttcatctgttcctcgatgtgcacatcactgcacaaacaccatt
ggctcttactactgccactgcagagaggggtttatactcaacggacacagtacatgtcaa
gctttaggtaatgctacccaactgctgatgatgcagaggaacagtataggacttctgaat
gtaaaatccaagcagttcacagccatcaaggctccagtgtcggacccagtggcgtcaaca
tacgacattactagggggtggtactactgggccgatggcagcgggagcatttacaaaact
aatggccgaaacacctgggcaacttttactggaccacctggaatcaaaggtctagcctgt
gattggctaaatggatacctgttttggaccaataagaagactgagtcaatctacatgcag
tcatctgatgataaaagctttacagctctactgagcaaaaatgtcagtccttcagaattg
gttcttctacccattgagaggtttatgttctggatcaatgaaggtctgggtgacagagtg
actttagagaggtcctggatggatggatcagacagaagcactctcgtggttcttactgcc
cagtttgcccacagcctcacagctgatgtagctgctagaagactctactggatcagtgac
tcaaagaggtccgtagagacggtgaagacagatgggactggccgatactctttcacaggg
ctctttagcaagagaccagctttcagccttgccgtctttgaaagcatgttcttctgggtt
gatcaaaagggactttggcaggctccccaagaccagtcaaatccaaagaagtttatcagg
aaaactgacttgcctctgttgtcagtcttccatgagcttcaacaacccaaaggctcttct
ccttgtgctaagactcattgtctcctctgtcaactgactaaaaataaccctgctggattc
acctgcgcttgtccatattttaaagtactgctacctgatgggacatgcaaatatccacgg
tttttatatggcactgtaacaacaatcagcttgttggagtttaaaggcaaagagtcctct
gaaacagaactgttttcttcaaaagaaggaatcctttcttttgatgtcgactggttcaga
gaatggttgtactgggccaaccaaactggccatgttcaacgcaccaagctaactctggac
aagactgagttcatttcaacacctttgccagtttgtctgctgtctgtggaccagaggagt
ggcaaccttttctgggtgtcatgtgaccagaacatcattggcaccagtgcagccagtaga
aattacccacagcagctgtaccacaccacaaaggagatcagcagcttttacctggactgg
ctgagaggtggaatgttctggttggaggaggacaggatctttggcatggggatgatggga
gaaaaggctaaggagctgctgcagatggcaggaggagtcagagggaatgtcgcctttgac
ctcagagccagcagtctcctctggaactctaaaagaggaggtctgacaacattgagtttg
ctgaaggagaaaagccaccaagcaggaagaaggtggaacgtctcaggctcagtagtggct
gcttttgagcctttccttttgtcgatctccaacaaagtgataactttgtgggatcggcgg
gacgggagcaaaattcagtcagtttctgtgaaaggtccagtgttgagtattatcactgta
ctcggggatattcaaacagtgcctgatacccaagtctgcaatgtgccgtcttggttgtgc
catcagtcatccatctgccttccacaaaatctgctctgcgatggcaaaagggactgccct
ggtggagatgatgaggagctctgtgtcagtgcctgtcctcaagaagactttatgtgcatg
gatagaagaaactgtattcccagaatccttctgtgtgatggccgtgcacactgtcacgat
ggttccgatgaagttgactgtccgacggttgcagctcctttatcacggacaaatgtcttg
aagtgtcgcagcggctcagtgctgtgtcaagatggcacagagtgtgttctgtacactcat
gtctgcgacggagaggcagactgtaaggatggatctgacgaactgggatgcgatgcaact
caagaacccacaagttctacgaagccaaacaaaaagcttcctgttaccaaagctcctccc
ttcattctgtcggcctgcctcagcccttctgtcctctgcccttcctttaaggcatacatt
tgcatttctcagagccagttttgtgatggcattaaagactgtccagatggctttgatgaa
caggactgtgctgagagatgccgtttaagaagtgattttctctgcaagaatcatcagagc
tgtgtgccaaagagttcagtctgtgacggccgacctgactgccttgatggctcggatgaa
gtgggctgtccaaacgtagctcaaggtgtacctcataatgggttaaaatgtcgctttggg
tccaaacgttgcagagatggcctatcatgtgttctcatgagccacatctgtgatggtgag
agggactgtcgggatggatcagatgaagatggttgtgacactgcaggaattgcaacaatt
gctcccaccacacctccatgcaccagtccttcagttctgtgtccaggttcttctagatgc
atcaaaccaacacagatgtgtgacgggcagagagactgtcctgatggatctgatgagaaa
tgtgtgaaaaggtgttcctatgagtctgatttccactgcaaagaccgtcgaagttgtgtc
ccactgagccaagtgtgcgatggtcgcgctcagtgtaacgatggctcagatgagctcaac
tgtccaagtgaagcgcctcctgcagctccaaataaaagcctaaaatgccactttggttct
aaactctgtcaggatggtctgagatgtgtccttctcagccacatttgtgatggagagaga
gactgtcaggatggatcagatgaagacagatgtgacagtgctgttgaaaatggaccactt
attggagctcctacacccactaaagaagtaattcagcctcccaccatgcctccatgcacc
agtccttcagttctgtgcccaggttcaacaatatgcatcaaacacacacagatgtgtgat
ggaaagagggactgccctgatgggtctgatgaaaaatgtgtcaagagatgtacctctgac
gctcactttcgttgcaaagaccgtcggcgctgtatcccaaagagccaagtctgtgacggg
cgttctcagtgcactgatggttcggatgaggtgaactgcctgagcgcagtggttcaagaa
gctccaaaagaagtgttgaaatgtcgctttggctccaaactttgtaatgacaggacggcg
tgtgttctgctgagtcacatctgtgatggagaagtggactgtcaggatggatcagatgaa
gaagcctgtgattcagagagtgctcctggtaattctatgggaaatgggctcttaagtaaa
tctccagagctgactaaaaaagtaacactacctcccactaagcctccatgcaccagtcct
tcagttctgtgtccaggttcatctatatgcatccaacacacacaagtgtgtgatggaaag
gaggactgtcctgatggatctgatgaaaagtgcatagaaagatgtccttctgaaagggac
tttctctgtagagaccgccggcattgcatcccaaagacccaagtgtgtgacggtcgctct
cattgtaacgatggttcagatgagattagctgtcaaagtttagtgcagcctgcatcgcct
actaaaatcctaaaatgccggtttgggtccaaactgtgtcgagatgggacatcgtgtgtc
ctcccaagtcacatttgtgatggagagccagactgtcaggatggatcagatgaagaagaa
tgtgacgagagcttgactcagtccccaacacccacaaaagaagtaactcagattctgact
aagcctccctgcaccagtccatcagttctgtgtccaggttcttctgtatgcatcaaaaca
acacagatgtgtgatggaacatgggactgtccagatggatacgatgagaaatgtgtggaa
agatgtccatctaactatttccactgcaaagaccgtcgaagttgcattccacggacccaa
gtgtgtgacggtcgctctcagtgcaatgatggctcagatgaggtcaactgtcaaagcgca
gcgccccctgctgctagtactaaagtcttgaaatgtcgttttgggtccaaactgtgtgat
gacggtacatcatgtgtccttctgagtcacttttgtgatggggatgcagattgtcacgat
ggatcagatgaagaaggatgcgacaatgggagcttaaatcagtctcccacacccactaaa
gaagtagctctgattccaactaatcctccctgcaccagcccatcagttgtgtgtccaggt
tcttctatatgcatcaaaccaacacagatgtgtgatggaacgagagactgtcctgatggc
tttgatgagaaatgtgtcaatcgatgtccctctgacactgacttccgttgtaatgatcgt
cgaagatgcatccctaaaaccaaagtatgtgacgggcgttctcagtgcgacgatggctca
gatgagatgaactgtcacaatggcgaggtggctcctaaagcgccatcaaaagtcccaaaa
tgtcgctttggttccaaactttgtcgggacaggatgaaatgtgtccttttgagccatgtt
tgtgatggtgagacagactgccaggatggatcagatgaagaaggatgtgatgctacagag
actgatgcccaaagttctgtggataatgactacatgaatgagtctcccaaaccagtcaaa
cgttttagtcagcctaccacctctccaccatgcaccagcccttcagttctgtgtccagga
acctccatttgcctcaaggccacacagatctgtgatcgaaggaaagactgtcctgatggg
tctgatgaaaaatgtgtgagaagatgtccaggcactgatttccgttgcaaagatcgtcga
agctgtgtcccaaaaagccaggtctgtgatggtcgctcccagtgcaacgacggctcagac
gaggttaattgtcggtcagtagagtctcgaccatctcagccaaatgcccttaaatgtcgc
atggggtccagaatgtgtcgcgatgggaccaattgtgtcctcttcagccatgtctgtgat
ggggaaagggactgtagggatggatcggatgaagaagggtgtgatgctgcagaaacaatt
gaatcctcatcccccaacaaacggttctgtagtttcccttcagttctgtgtcctgattca
aatgtttgcatcaacccgtctcagttatgtgatgggatcagagactgccctgatggatct
gatgagaactgtgtgaaaaagtgtgctgacaaaaccgactttctctgcaaagaccgtagg
agctgtgtgtctaggagtctagtttgtgatgggcgcgctcactgctatgatggctcggat
gaggctgactgtcggagtgtaactgctccaccgcttaagtccaatgtgttaaagtgccgc
atgggctcaaagccatgcaaagatggcaaagattgtgttttatttagtcatgtttgtgat
ggagaaatcgactgcatggatgggtctgatgaagaaggatgccaagaaacatgtgatgaa
ggagagtttcagtgtgcccatgggaagatgtgcatccctgagaatgaggtttgtgatggc
aagccacagtgtcgggaccactctgatgagatggactgctggcagcgaacaaagagctgt
gaacaccgttgtgctgatggcaaacggtgcatcccaaagaagttcctctgtgatggagag
ccagactgcttagatggaacggatgaactgaactgtgattctgttccaacagattttcct
attacctcaacatcagcttgcatcactccttcagttctgtgcccaggctcatcacggtgc
atctctcaacaccaattgtgcgatggacaaagggattgcccagatggctttgatgaaaag
gaatgcatagttcaatgtgaaaacccagcggacttcctgtgcaaggaccagaggaagtgt
atcccaaagactcaagtgtgtgatggccgtaacaattgtccagatggttcagatgagaag
cagtgccaatcagaacttacatctgcatcttctattaatgcaccaagaacaaggcatagg
cctctaaagtgccgcacgggtttcaagctgtgtaaaaatggcctggagtgcatcatgtac
agccatgtctgtgatggagagcgtgactgccaggatgggtctgatgaggagggatgtgag
aagcaatgcaagccaggacagttccagtgttctcatgggagaagatgcatccaacaagag
caggtgtgtgatgggcagaatgactgtcaggaccattcggatgaaacagactgctcaaaa
ccaattgaaggctgccatcacctttgtgacaataagactcgctgcgttccgaagaccttt
ctttgtgatggagaaaaggactgcactgatgggtcagatgaagataaatgtggttcagta
gcctgtgctccacatcagcatcgttgcgaaagcgggcagtgcatttctgaggcgtttaaa
tgtgatggttatcctgactgccacgaccactcggatgaggcgggctgtccaagagcccct
cgttgcccggcacagctccagtgcccacacagccatgaatgcctgcagaaagagtggctt
tgtgacggagaagaggactgtaaagatggctcagatgagaataactgcaacaaccctcca
acaaagtgcaggaagtaccaatttcagtgcagaggcagcggtttgtgtattcctcaatcc
tggaggtgtgatggaaaagaagactgtgacaatggagttgatgaggataaatgcacccaa
aggaaatgcccctaccacctttaccaatgtggcagcaaagaatgtctggaaaccaggctg
gtgtgtaatgggatcaacaactgtattgatggctcagatgaaggtgtgggatgtgctcaa
cgcaactgctcaagtccttcagctcctacctgtgaccacagatgtgtcagcacccctaat
ggaccgaggtgttactgcggtgtcggtttcaggctgcagtccagctccaagtcctgtatg
gacattgatgagtgcacttcaacagcagctacttcatgcagtcacctttgccagaacact
cagggatcctacagctgtctctgccaccctggcttctatcttgagccagataacaaaagc
tgcaagacaaaagatgagcctctgcttttggcttcggtgcagtccgaaatgctaatactt
ggagtccatagcggtacattgcagcttctctcctctgctgaccggccagtttttgctctg
gattttcactgggctgagcagagagtttactggcagagccccgaccaccagagcatccgc
tgggctgacatgaaatctaaaaccaaagggacgctgaccaaaggcgtgaagtctgattca
attgcagtggactgggttggtaagaacctgtactgggtggatggactggttggacagatt
ctggctataaagctaagcagttcaatcatgaaatctcaggactatactgtagttcttggg
gaaaacctggagcagacaagctcattggtcctgataccagacaagggattgatgttgtgg
tctgagattggcagcatccctcaaatcgagcagtctgggatggatggctcccagaggaaa
gtactggtgagccaggacttgagctggccagtcagtctggcctatgacttcctggatgac
aggatctactgggctgatgagaagctgcactgcataggctcagcctcgctggatggagac
aacataaagatcctccagttgacagaaactccaagccctttttctgtggcggttttcagc
gaccgcatgttctggtctgacaccaagagaagaactgttcgttcagctgacaagaaaact
ggcaagaatcaaactgttcttctgaagagacctgggcagccatttggattaaaactgatg
catgccctctcccaaccacctgtatcaagcccttgtgatcatcttcgatgctccaatctc
tgtcttttggctccagcaccaggaaaatctagagctggagctccagcagtaaatgctgca
gtttgtcgatgtccaaagggtctgcttctttctcaggacagaatgacctgcgttcttccc
aaagagtcatctttcatcctgcttttgtcccacaacaaaatatctcagatctacttgcgc
tctatgcgccgtcacggaatcgcactgaagaaaatgccaaatggcagagacttcaatctc
ccaggagtacctgaggctatgagtctggacatttccttctcggagctcttggtgtttgtt
gcttatttaagacatggatctgtggatgtgctaaaactcaccaactccctatcaaaacca
gagcttgtgcttgctggacaaatcataaagttacaggatgactcggtaactgctctggca
gtggactgggtgacctccaatctgtactggagcagcatgaagaggccggacatacatgtg
acgtcacgtcttgagaaccacaccacctctctgctgcaaggacccctcattggagttgca
tcaatcaccctccatccttcctcgggtaggctctgctattttgccatagtaataatgggt
tcaaggagccagacggagatccactgtgcatggatggacggccgtaataaagtagtgctg
tggaagcggttaagcattcctatctccatggttttcactaatgatggaaccagaatctat
tgggctgacactggtgaaggaataataggatctattggagtggatggatcggcttatagg
gagtacaaaacgggacccaatctgcttgtgtctttcacgcttattgagaactttttcttt
tgggtcactcaagacaaagatgtcagcaaattgtggttcagtgatggactccaaccgaag
cagttgtggttccaaacaaagacaaagatatccgaaatcaggtcctacaacaatgaaacc
caatcgggaagcaaccattgctcaaacagcaacggtggatgtgtccacctctgcctgccc
tatccaggaggtcggacttgtaggtgtgcatggggcttttacagtgtaaatgacacgtcc
tgtgtcccacttccttcctgcccctctggagaggaatcctgtttagatggcagccagtgt
atcgggagcaagaagttctgtgacgggcgtgcagattgtccagaccagtcagatgaacag
gactgtccaggatctgcctcatttggaaccgtagttggtggtgaccaatccccacagtct
tcccttcaccaacctgacactcagaaaaacaccattgtgcctaatgaagtcttggcatca
tgcgatctccagcgctgcaatggccacggcaactgcatcacagagggcgaagtcactcgc
tgccactgtctacaaggttacatgggagaattctgccagactcaacaaagacaaagtcac
ccagcaatcatcctggtgtccatttgtctggtctctgcagtagtagtgggtgcactcgtc
ttcactaaaagaagatgggaatacatgagaaatacatctgcagataaagagaacctaatg
acaaatatggttattccaggtgaacaagattctgattctgaggagctggaatctcctgta
gatgtgaagaacccactgccaattaaatga

KEGG   Xiphophorus couchianus (Monterrey platyfish): 114150115
Entry
114150115         CDS       T05908                                 

Definition
(RefSeq) growth arrest-specific protein 1-like
  KO
K06232  growth arrest-specific 1
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:xco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    114150115
SSDB
Motif
Pfam: GDNF
Other DBs
NCBI-GeneID: 114150115
NCBI-ProteinID: XP_027882136
LinkDB
Position
8
AA seq 261 aa
MERVLLLICCELIIAIGTCGGSPNHNHRPVCWKAILGCQGEAECRYAYGQYLHACASVIS
GVRRKCPSHCISSLIQLNLTRHGPDLEDCDCAADPVCRSTQRAIDPCMPRTSAMGCTEAR
LQCEADPACSSAMADYLLHCRKLFGGQRCSESCRKMIAKMRSMPRAQQLDACVCDGTDRN
ICEYIKERMKTLCSESGDRFAGSGFGDSEEDTEEDDIYQDYYVENSGSSPTYQTHLKTLT
FMVAVAGFIWKDCYLLQFFFF
NT seq 786 nt   +upstreamnt  +downstreamnt
atggagcgggttctacttctgatatgctgcgagttgatcatagccatcggtacctgtggc
ggatctccgaaccataaccatcgccccgtgtgctggaaagccatcctcggatgtcaggga
gaagccgagtgccgttacgcgtacggccagtacctccacgcctgcgcgtccgttatcagc
ggcgtgcgcaggaagtgtcccagccactgcatctcatctctcatccagctcaacctgacc
cggcacggcccggatctggaggactgcgactgcgccgcggacccggtgtgccggagcacc
cagcgagccatcgacccgtgcatgccgcggaccagcgccatgggctgcaccgaggcacgg
ctgcagtgcgaggcggacccggcgtgcagctcggcgatggcggattacctgctccactgc
cggaagcttttcgggggccagaggtgctcggagagctgccgcaaaatgatcgccaaaatg
cgctccatgccgagggcgcagcagctcgacgcctgcgtctgcgacggcaccgacaggaac
atctgcgagtacatcaaggagaggatgaagactctgtgctcggagtccggcgacaggttc
gcgggcagcggattcggggactctgaggaggacacggaggaagatgatatttaccaggat
tattatgtggagaactccggcagctctccaacttatcaaacacatctgaaaactttgacc
ttcatggtggctgtcgcaggattcatctggaaggactgttatctgttacagtttttcttt
ttttaa

KEGG   Xiphophorus couchianus (Monterrey platyfish): 114151668
Entry
114151668         CDS       T05908                                 

Definition
(RefSeq) low-density lipoprotein receptor-related protein 2-like
  KO
K06233  low density lipoprotein-related protein 2
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:xco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    114151668
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:xco04131]
    114151668
Membrane trafficking [BR:xco04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Low-density lipoprotein receptor (LDLR) family proteins
    114151668
SSDB
Motif
Pfam: Ldl_recept_a Ldl_recept_b FXa_inhibition cEGF DUF5050 EGF_CA SGL SKG6
Other DBs
NCBI-GeneID: 114151668
NCBI-ProteinID: XP_027884804
LinkDB
Position
10
AA seq 4618 aa
MALLGLHLLSLLLLSQGIHLIQGSCASDEFQCRNGQCINKAWRCDGTKDCTDDSDELNCP
PPSCSSQEFKCVTSGECISLGFVCDGEEDCVDGSDEQRTCDGRTCRPDQFTCQEGQCIPS
KYRCDRVTDCVDNTDEKNCNYPQCTQKTCANGACYNNSQHCNGLQDCRDGSDETNCTTHH
CPIHQFECVNGFCVPLAFVCDHWDDCGDNSDEQDCEYPTCSGSEFTCSSGRCIPQNWVCD
KFNDCGDFSDESGCDSDSRDCYPGEWGCPGSTACITLGKVCDGKPDCPGATDETNTTVHQ
TCGLDRCSALSCEYLCHPSPQGGTCYCPDGFIVANDSRSCVDYDDCNIWGICDQLCEDRP
GTHHCSCADGFFLEQGHVCKANVSGGLPQLIFTNGGDVLMADIHGRFVRTLVPAQGKGYA
VGVAYNIRSNVVFWSDTNTKKVYSASYNGENIKEILTTAVPNVQNLAVDWINFKLYVLDA
TLDRIDMCDYDGGNRVTLVAENLETPHGLALDPTVGYMFFSDMGVSQEKTKLERAFMDGS
NRVEIIKSRLGTPTAITLDIITKRVYWSDSHFDTVETVTYSGLDRKIVLNGAMQSPHPFG
MAVFENHVFFTDWTKMGVIRTNRFNGSNPTLLYRTANRPGHVVVSHSAVQPFVINPCGRH
NGGCQHICVLSHRSDNGGLGFRCKCRYGYDLGSDRHSCFKIKDYLLVASSLAIRGIPLNL
SLQEDVTLPLTGLGSSFSGSAVEFDGNEEAVFYNDRSKGLIYKSNLNGTAQQILTGKTVG
IVDAMAYDWTSKVLFWTTSTYRAVVAFRVTDKSKKDIVTGLRYPKGIAIHPSAGYLFWSD
WYRPAVIMKAFPDGSNAVPLVNTTLGWPYGLALDYVMDRLYWVDSLLDQVGHISIEGTDR
QTFTSIGQITQPYSLTVYSDYLYISDTRTRAIFEMRKRDAGGSIMIRQGVTGILNIKAYS
ADLHGTFNSRCNSVPNGLCSHFCFPTPSLSRVCGCPYGMKLQANQRDCIKDDSVPPPDDC
GDYAFECDEGRCRPNSFRCDGIFDCVDKTDEANCTDTGSTCSPYAFTCNNKHCIYSSWRC
DGHDDCGDGSDEVNCPTRVPTTCGSSYFTCNNNKCISKNWVCDGENDCGDGSDEQNCDSS
ITTCPPGYFLCPDHRCISDFYVCDGDQDCLDGSDEKNCEFSCQSYEFACASGDQCISSYY
RCDGVFDCRDHSDEQNCPTRGPGLCHNDEFQCQTDGFCIPDEWECDGHPDCEDGSDEHNT
CPAVTCSSSYFQCTNKMCIPMSWLCDGENDCRDMSDEQNCPTPPFSCPSGQWLCPTDQVC
IDLDKVCDGQRDCPNGADESPICNQDDCALNNGGCTDGCIQGPFGAQCTCSPGFQLLNDS
KTCDDIDECLIPGFCSQQCYNERGSFRCHCSHGYLLEPDGRTCKVTDPHAAVLLVAQRSQ
ILANRLIMRPPLIRPVATGSNIVTVDFDRETSRIYWADAIQKKIWSAFQNGTEKREVFST
GLMVPESIAVDWVGRNLYWTDSDLENIEVSTLDGHYRKVLLNKNVTSPRGLALDPRNHTY
LMFWSDWGQNPRIERASMDGAMRQVIVSTKVYWPNGLALDYTTHRVYFADAYLKYIDYCD
YDGRNRHQVMASDLNLQHPHGMTIFEDSVYWSERYTGKVMSTNKFHGGNITILFNNIYQP
MGIVMDHPVKQPAAINPCREHLCTQLCLLSTMRPRYYTCHCQSGWKLDSDQRTCIKDDSP
FLMVVRDTVIFGIPLDPTDPSNNAMAPISGITEGQDIDFDDKEQYVYWVQGTSSIWRIKT
NGSDRAQFAPAAYMGSPSGLAFDWISRIMYYTNPTSQTIEVIRVDGNEKYRKTLIASTGK
PEGAGKPFGIALDPVRGKLFWTDKGSDKGVPPKVGSADMDGSNLKNLYTTNLANIGFITA
DISTTKLYWGVSGSGVIECGTMDGVTRVTVVSGLSHPGGLTVYQNHLYYTDLDYEVLERV
DKDTGANMVVMRSGLSGLHALKVHARDNSAGTTNGCSTNNGGCPHLCLPKPENQKTCACT
TGFYPSHDGSRCEEYESFAVVSTSEYIRGFHINSSDHSEAMVPVGRSYYSTKNKVDLHIE
SGFVYWSEDSSYSSYRGIFRAKTDGGSFSRIINSGVGVGGIQGLAVDWIAGNLYFTNAFE
KETFLEIQSINSSYRMILVRSFEDQPRDLAVSPKLRYLFWTDGGQSPKIERALLDGTNRT
VLASESLASPRALTVDYTNNFLYWTDDVLDMISRMAVDGTEREIIRYGSRYPSPTGLAIF
GNYMLWVDKKLDKLFQASKDPANTNQTEVIRDSLNGVMDVAVFDSHVQPTSANLVGFNPC
HEDNGRCQQLCFAIPEQQKPKCACAHGSLLSNGVTCGYGQDEFLVFTTDYTLNSLRLDPT
DHSLPFPTVNLDYNVIALDFDYKERRIFYTQSKGLGRSIIGYITTSITSPPVILASNLDD
PDGLAYDWIHKRLYFTDYATRNIQSIGLDGQNRSVIAHAYRPRGIIVDPCYGYLYWTDWG
TPAKIERATLGGNFRTAIVNDSLITPNGLSIDYEERMLYWADASLYKIERATLNGENREV
ILQGVQYPFSMTVFQQDIFWTDWTERGVFRAGKDDGSGYTVLAQDLQYRPNDIHIYASSK
QEACVSFCQQFNGGCSDICVSGPVGPECQCPHEGNWYLANNGKDCIKDTGKRCQPEQFTC
LNGNCISARWKCDGFNDCNDRSDELERVCAFHTCSPLDFTCDNGRCVPMSYVCDYTDDCG
DNSDERGCAFPTCNPTVDFTCANGRCINSAYVCDGRNDCRDNVTSDEINCPDRVCPGGQI
KCERNNICIFPENLCDGYNNCGDNSDENPLFCAGRTCAANQFSCDEGKCIPQSWVCDSIT
DCADKTDEPPSCVDIVKTCAAGEFTCTNGNCIPQSVVCDGNNDCWDNSDEAPELQCGERT
CSSNQFTCPTWYPGHPRCVPLNAVCDGEKDCANAADELQNCPIRNCHMNEFACANGLCIL
IPYHCDRVNDCGDGSDELNCKYDTCSSSQFTCGNGACIPASYTCDGSNDCLDGSDEADSL
CVTLQPTCSPQQYMCSSGECIDLHKVCNGQKDCQDNSDEKGCGVNECLNTQVHQCAQLCT
DTLTGYYCSCNPGYRLMPDGKACEDINECTTTPAVCSQICENSVGSFHCKCAPGYIREPD
GRTCRQNSGVPSYLLYTNRYYIRYLYVDGTKSGIAQQGLSNVVAVDYDDYEKWLYWLDVG
AGKIERMRFDGTGRETLVAHNIGGAEGLVVDWVGRKLYWVDSYYSSVHVMELDGRYQKKL
VTGEFKNGNDTYFISRPRAVAINPKYGWLYWTDWGDKAYIGRVGMDGRNISAIITTKLEW
PNALTIDYTTNKIFFADSHLNFLDYADMDGQNRHRAIAGTLPHVFAASLFEDWIYWTDWN
THTLERAHKYTGEQRIIMGNNTHRPYDIRVHHPYRQPRSENPCSSHHLTCSHLCLIAPGG
QQASCECPDHFIGIALGFQIQCVADCSSTQFRCGDNEKCVPIWWKCDGQSDCGDGSDEPQ
TCPPRYCRIGQFQCRDGNCTFPGFLCDGHPDCPDSSDEDAALCSDHRCEVNQFQCKNKKC
IPVSWHCDGFTDCSDGSDEDAETCAQKTCRPGEFKCANGRCLPSSYVCDAQDDCGDGSDE
PFETCMGPEYKCDEDTEFSCKTNYRCVPQWARCDGTNDCLDNSDEEGCEELTCDPLGDFR
CDNHRCVPIRWKCDGADDCGDGSDERNCEPRSCTESEFRCDNAQCIPGNWRCDHDNDCGD
NSDERDCELLTCRPGFFQCNSGHCIPTALQCDGQADCLDLSDETSCPTRYPGGRWCRPNQ
FQCANRLCVSPSWVCDGVNDCGDRSDEVLSLCLNVTCKMPSRFRCANGYCIYSGLLCNMK
DDCGDGSDEDEVLCREPTLAPCTLEEFKCTNGHCVALAYVCDHNDNCGDHTDEMGCNFGQ
DRNCDEKLCQHVCTNLDGTGFICSCRTGYKVDPDSTYNCLDIDECKEYGTCPQVCKNTKG
SYDCECSSGYRKVGEGKMCEAEGAAPLLLLPESVRIRRFNLQAETYHDFLQEEERIMALD
YDWDHNNTGFSMVYFTVAGKDSEPGAIKRAYIPSVDDGSNNIAAAVDLGIKYITTPDGIA
VDWVGRNLYWADSRLKRLEVAMLDGRYRKHLVKTDLGYPSAVAVNPRLGMLYWADRGDVA
KIECSWLDGQERKVLVADGLGWPTGLSIDFANGDRIYWSDSKESRIESVLPSGEQRRTAV
FIDVRNPFSVCVFEDHVYWSTQEKGEIFRQDKFGQGDKVKLLTAGPWLTQISVYQQQRYN
SMAIKNPCKGTCSHLCLIRPGGYTCACPEGTNFITGSNTECDAGFDPPPTMPPPCQCQNG
GTCYFDDNKALCICPSAWKGDYCQTSVHNVVASSVGIAIGVTVLVVALLVALVYFCRKKS
NIMERLQGSLPSMPSMPSMPSMPSMPTFSGLRNGFTQNGPNTEENESRPNGDTVPSISVS
IFDTEGKSFENPAYEAEGQPGSTSRVTPTSTPAQTHKENIINPLYVEEGQAMGDLTTSSA
KSAISKEAVGAFEEDVDVASSSRVAMEQIKPTQDEGSGAVVNPIYMAYERESTSDSDV
NT seq 13857 nt   +upstreamnt  +downstreamnt
atggccctactgggtcttcatcttctgtctctgttactgctgtcccaaggaattcacctc
attcaaggaagttgtgccagtgatgagtttcaatgcagaaatggacaatgcatcaacaaa
gcttggaggtgtgatggaactaaggactgcacagatgactctgatgagctgaactgccca
cctccgtcatgcagctcgcaggaatttaagtgtgtgacaagtggtgaatgcatctcactg
ggatttgtctgtgatggggaggaggactgcgttgacggatccgatgaacaaagaacctgt
gacggacgcacctgcaggccagaccagttcacctgccaggagggccagtgcatccccagc
aaatacagatgtgaccgagtgacggactgtgtggacaacactgatgagaaaaactgcaat
tatcctcaatgcacccagaagacatgtgcaaacggagcctgttacaataactctcagcac
tgtaatgggctacaggactgcagagacggatctgatgagaccaactgcaccactcaccac
tgtcccatccaccagttcgagtgtgtgaatggcttctgtgtgccacttgcgtttgtgtgc
gaccactgggacgactgtggggataacagtgatgagcaagactgtgaatatccaacctgc
agtggcagcgagttcacttgttccagtggccgctgcattcctcagaactgggtgtgtgac
aagttcaacgactgtggagacttcagtgacgaaagtggatgtgatagtgactctcgggac
tgttaccctggtgagtggggttgcccaggctcaactgcatgcatcacattgggtaaagtg
tgcgacggcaaacctgattgtcctggagcaacagatgagaccaacaccacggtacatcaa
acatgtggtctggaccggtgctctgccttgagttgcgagtatctctgccacccttctccc
cagggtggcacatgttactgccctgatggatttatagtagctaacgacagccgctcctgt
gtagactatgatgactgtaacatctgggggatctgtgatcaactttgtgaggatcgacct
gggactcaccactgtagctgcgcagatggattcttcttggagcagggacacgtctgcaaa
gccaatgtgtcaggagggctgccacagctcatttttacaaatgggggagacgtgttgatg
gctgatattcacgggcgctttgtcagaactctggtgccggcccagggcaaaggttacgcc
gttggggtggcctacaacattcggagcaatgtagtcttctggagtgatacaaatacaaaa
aaggtttattctgccagctacaacggggaaaacatcaaggaaattctgaccactgcagtc
ccaaatgtccaaaatcttgcagtggattggatcaactttaaactttatgttttggatgca
actctggatcgaattgatatgtgcgactatgatggagggaatcgagtcacgctggtggct
gaaaacttagaaactcctcatggcctcgccctggatcctacagtgggctacatgtttttc
tcagacatgggtgtgagccaggagaagacaaagctggaacgggccttcatggacggcagt
aaccgcgtggagatcatcaaaagcagactcggcacacccactgcgatcaccctggacatc
ataacaaagagggtctactggtccgacagccactttgacacggtggagacggtcacatac
agcggtttggacaggaaaatagtcctcaacggtgcaatgcagtcaccacatccttttggg
atggctgtttttgaaaaccatgtcttcttcactgactggaccaagatgggggtgatcaga
accaatcgcttcaatggcagcaatcccactctcctgtatcgtacggccaatcgaccagga
cacgttgtcgtctctcactctgccgttcagccttttgtcataaacccatgtggcagacac
aatggcggctgtcagcatatttgtgttttaagccaccgctcagataatggtggtttgggc
ttccgctgtaaatgtcgctacggttacgatctgggatccgaccgtcatagctgctttaag
attaaggactacttgttggtggcttcctctctggccatccggggaatccctctgaactta
tctctccaggaggacgtcactcttcctctgactggactcggatcctctttttctggctcc
gctgtggaatttgatgggaacgaagaggctgtgttttacaacgacaggtccaaaggactc
atttacaaatccaacctcaatgggactgctcagcagattttgactgggaagacagtggga
attgttgatgcgatggcttatgactggacttccaaggttttgttctggaccacatcaaca
tacagggcagtggtggccttcagagtcacagacaagtccaaaaaagacattgttactggg
ctcagatacccaaagggtattgcgattcatccaagtgcaggatacttgttctggtctgac
tggtaccgtccagccgtcataatgaaagcattccctgacggcagcaacgctgttcctctg
gtcaacacaacgctgggatggccgtatggactcgctctggattatgtaatggacaggttg
tactgggtggattcccttctcgatcaggttggccacattagcatcgaaggaactgacaga
cagacattcaccagcattggccagatcactcagccatactcgttgacagtttattcagac
tacctctacatatctgacacaaggactagagcaatatttgagatgaggaagagggatgca
ggaggaagcataatgatcagacaaggagtcaccggcattttgaacatcaaggcctattca
gctgacctccacggcaccttcaacagccgctgtaattcggtgcccaatggactctgcagc
cacttctgtttcccaactccctccttgagccgggtgtgtggctgtccgtacggcatgaag
cttcaggccaatcagagggactgcatcaaggacgattccgtccctccgcctgacgactgc
ggcgactacgcctttgaatgcgacgaaggacgctgcaggcctaactctttccgctgtgat
ggcatttttgattgtgttgacaagaccgatgaggccaactgcactgatactggatcaacc
tgctctccgtacgccttcacctgcaacaacaagcactgcatttactccagctggcgttgt
gacggccacgacgactgtggagatggttcagatgaggtcaactgtcccactcgtgttcca
accacctgtgggtcttcctacttcacctgtaataacaacaagtgcatctccaagaattgg
gtgtgtgacggtgagaatgactgcggtgatggctctgacgaacagaactgcgattcatcc
atcaccacatgcccccctggctactttctgtgcccggaccaccgctgtatcagcgacttc
tacgtgtgtgatggagaccaggactgcttggatggatcagatgagaaaaactgtgagttc
tcctgtcagtcctatgagtttgcctgtgccagcggagaccagtgcatcagctcctattat
cgctgcgatggcgtgttcgactgcagggaccattcagatgaacaaaactgccccactcgg
ggtccgggcctttgccacaacgacgagttccagtgccaaactgacggtttctgcatacca
gacgagtgggagtgtgacggccatccggactgcgaggacggatccgatgagcacaacaca
tgcccggccgtcacctgcagctccagctacttccagtgcaccaacaaaatgtgcatccca
atgagctggttgtgcgatggcgaaaacgactgtcgggacatgagcgatgaacagaactgt
cccacccctcctttcagctgtccctctggacagtggctgtgccccaccgaccaagtgtgc
attgacctggacaaggtgtgcgacgggcaaagagactgtcccaacggagcagacgaatca
ccaatctgcaaccaagacgactgcgctctgaacaacggaggctgcactgacggttgcatt
cagggaccgttcggggctcagtgtacctgctcacctgggtttcagctcctcaacgactcc
aagacgtgtgatgatatcgacgagtgtctgatccctggtttctgcagccagcagtgctac
aacgagagaggaagcttcaggtgccactgctctcacggttacctcttagagccggacgga
cgcacatgcaaagttacagacccacatgctgctgtacttttggttgcacagcgtagccaa
atcctggccaacagactcatcatgaggccaccactgatccgtccagtggccaccgggtca
aacatcgtgactgtggactttgaccgtgagacttccaggatctactgggctgatgccata
cagaaaaagatatggagtgcctttcagaacggtacagagaagcgagaggtgttttccact
ggtttgatggtgccagagagcattgctgtggactgggtgggtcgaaatctttactggact
gactctgatctggaaaacattgaggtttcaactctggacggtcattatcggaaggtcctc
ttaaacaaaaatgtaaccagccctcgtgggcttgctttagatccacgcaaccacacctac
ttgatgttctggtccgactggggtcagaaccccaggattgagcgagccagcatggatgga
gccatgagacaagtgattgtcagcactaaggtctattggcccaacggtctagctctggac
tacaccacacacagagtctactttgcagacgcttacctaaaatatatcgactactgtgat
tatgatggcagaaaccgccatcaggtcatggcaagtgacttgaatctccaacatccacac
ggtatgactatatttgaggacagcgtctactggtcggagcgctacaccggcaaggtgatg
agtacgaacaagttccatggtggaaacatcacgattcttttcaacaatatctaccagcca
atgggtatcgtaatggaccatccagtcaaacagccagcagccatcaacccttgcagagag
cacctttgcacacagctgtgcctgctgtctaccatgaggccgaggtattacacctgccac
tgtcagtctggctggaagctggattcagaccagcgcacctgtatcaaagatgactctccc
ttcttgatggtggtgagggacactgtgatctttggcatccctctggaccccactgaccct
tccaacaacgccatggcccccatatctggcatcaccgagggacaagacattgactttgat
gacaaggagcaatatgtgtactgggtgcaaggcactagttcaatttggcgaatcaaaacc
aacggcagcgacagagctcagtttgctccggctgcttacatgggctcgccatctggtctg
gcctttgattggataagccgaataatgtattatactaatcccaccagccagaccattgaa
gttattcgtgtagatggaaacgagaaatacaggaaaaccctcatcgcctcaactggaaaa
ccagagggagcaggaaagccttttgggattgcactagatcctgtccgagggaagctgttt
tggacagacaaagggtcagataagggtgttcctccaaaggttggcagcgctgatatggat
ggaagcaacctgaagaacctttacaccacgaacctggcgaacattgggtttatcactgcc
gacatctccaccacgaaactgtactggggggtctcagggtcaggggtgatcgaatgcggc
accatggatggagtgacccgtgttacagtggtcagcggcctgtctcatcctgggggcctt
acagtctaccagaaccacctgtactacaccgacctggactatgaggtccttgagagggtg
gacaaggacactggagccaacatggtggtgatgcggagcggcctgtctggcctgcatgcc
ctaaaagtccacgccagagacaactcagcaggaactacaaatggctgtagcaccaacaat
ggaggctgtccacacctctgtctccccaaacctgagaatcagaagacatgcgcctgcact
accggattttacccatctcatgacggctcccgctgtgaagagtatgaatcgttcgccgtc
gtctccacatctgagtacatccgtggcttccacatcaacagctcggaccactctgaggcg
atggtgcccgttggtcgatcatattattctactaaaaacaaggtggacctccatattgag
tcaggctttgtttattggagtgaagacagcagctactcgtcatacagaggcatcttcagg
gccaaaacagatggaggaagtttcagccgtatcatcaattcaggtgttggagtaggaggc
attcagggtttggctgtggactggattgcgggcaatctgtacttcaccaacgcctttgaa
aaagaaacttttctggagattcagtccatcaactcctcctacagaatgatactagtgagg
agttttgaggaccagcccagagacctggcggtcagccccaaactccgctacctgttctgg
acggatggtggccagtcacccaagattgagcgcgccctgctggacgggacgaatcgcaca
gttttggcctcggagagcctggcgtcacctcgggctctgactgtcgattacaccaacaac
ttcctgtactggaccgacgatgttcttgacatgatctcccgcatggccgtggacgggacg
gagcgggagatcatccgctacgggagccgctatccgtctccaacgggattggctattttt
ggaaactacatgctgtgggtggataagaagcttgacaagcttttccaggccagtaaagac
ccggccaatacgaaccagacagaagtgatccgggacagccttaacggggtgatggatgtc
gccgtcttcgactctcacgttcagcccacctctgccaacctggtgggcttcaacccctgc
catgaagacaacggacgctgccagcagctctgcttcgccattcccgagcagcagaaaccc
aaatgtgcctgcgctcacggctcgctccttagtaacggtgtcacatgcggttacgggcag
gacgagtttttagttttcaccaccgactacacgttgaatagcctaaggttggacccaacg
gatcacagccttcccttccccacggtgaatttggactacaatgttatagcgttggatttc
gactacaaagagaggcgaattttctacacccagtcaaaggggttaggtcggagcatcatc
ggctacatcacaacatcaatcaccagtccgcctgtaatcctggcctcaaacttggatgat
ccagacgggctggcgtatgattggatccacaagcgtctctacttcaccgactacgctacg
cgtaacatccagtcgattggcctggatgggcagaaccgctcagtcattgcccacgcatat
cgtcccagaggcatcatcgttgacccgtgctatggttacttgtactggactgattgggga
accccagctaagattgagagggcgacgctaggtgggaacttccggaccgccatcgtcaac
gacagtctgataacaccaaatggcctgtctatagactatgaggagaggatgctctactgg
gctgacgcctcgctttacaaaatcgagcgggccaccctgaacggcgagaaccgagaggtg
attcttcagggagtccagtacccgttttccatgaccgtgtttcagcaggacatcttctgg
acggactggacggagcggggtgtgttcagggccggaaaggacgacggctcgggttacaca
gtgctagcccaggacttgcagtaccgacccaatgacatccacatttatgcgagctccaag
caggaggcgtgtgtcagcttctgtcagcagttcaacggaggctgcagtgacatctgcgtt
tccggtccagtgggcccggaatgccagtgtcctcacgaggggaattggtaccttgcaaat
aatggcaaagattgcatcaaagacacagggaagcgctgtcagcctgaacagttcacctgt
ctcaacggcaactgcatttcagctcgctggaaatgcgacggcttcaacgactgcaatgat
cgctccgacgagctggagagagtgtgcgctttccacacttgctcaccgttggacttcacc
tgcgacaacggtcgctgcgtcccgatgagctacgtctgtgactacaccgacgactgcggt
gacaacagcgacgagcggggctgcgccttccccacctgcaacccgacagtagacttcacc
tgcgccaacggacgctgcatcaactcggcctacgtctgcgacggacgcaacgactgtcga
gacaacgttacatctgatgaaatcaactgccctgaccgtgtgtgtccaggtggccagatc
aagtgtgaacgcaacaatatctgcatcttccctgaaaacctgtgtgacggctacaacaac
tgtggtgacaacagcgacgagaaccccctattctgcgccggccgtacatgcgctgccaat
cagttcagttgtgatgaaggaaagtgtattcctcagtcatgggtctgtgactccatcact
gactgcgctgataagacggatgagcctccttcttgtgtggacatagtcaaaacatgtgct
gctggcgagttcacatgcaccaacgggaactgtatccctcagtccgtggtttgtgacggc
aacaatgactgctgggacaacagtgatgaggctccagaactgcagtgtggtgagcgtacc
tgcagttccaaccagttcacctgtccaacctggtacccgggtcaccctcgctgcgtgccg
ctgaacgccgtgtgcgacggggagaaagactgcgctaacgcagccgacgagctgcagaac
tgtcccatccggaactgccacatgaacgagtttgcctgtgccaacggactctgcatcctc
atcccataccactgtgaccgcgtgaacgactgcggagacggcagcgacgagttgaactgt
aagtacgacacctgcagcagcagccagttcacctgcgggaacggagcctgcatccccgcc
tcctacacctgcgacgggagtaacgactgcctggacggttcagatgaggccgacagcttg
tgcgtcacgctgcagccgacctgctcgccccagcagtacatgtgcagctcaggagagtgt
attgacctccacaaggtgtgcaacgggcagaaggactgccaggacaacagcgatgaaaaa
ggctgcggagtcaatgagtgtttgaacacacaggtccatcagtgcgctcagctctgcaca
gacaccctcaccggctattactgctcctgtaacccaggctaccgcctcatgcccgatgga
aaagcctgcgaggacatcaacgagtgcaccaccacgccggctgtgtgcagtcagatctgc
gagaacagcgtcggctctttccactgtaaatgcgctcctgggtacatccgcgaaccggac
ggacgcacctgtcgtcagaacagcggcgtcccctcttacctgttgtacaccaatcgctac
tacatccgttatttatacgtagatgggacgaagtctggcatagcgcagcagggcttgtca
aatgtggtcgctgtagattatgatgactatgagaaatggctgtattggctggatgtgggt
gctggaaagattgagaggatgcgttttgacggcactggcagagagacactagtggctcat
aacatcggaggagctgaaggcctggtagtagactgggtgggaaggaagctgtactgggtg
gatagttattatagctcggttcatgtgatggagttggacgggcgctaccagaagaagctg
gtgaccggagagttcaaaaacggaaatgacacgtatttcatcagccgaccgcgcgccgtg
gccatcaaccccaaatatggatggctgtactggacagactggggcgacaaagcgtatatc
ggtagagttggcatggatggcaggaacatcagcgccatcatcacgaccaaactggagtgg
cccaacgctctgaccatcgactacaccaccaacaaaatcttctttgctgattcacatctt
aactttttggactatgcagacatggacggccagaaccgacaccgggccattgctgggact
cttcctcacgtctttgctgcttccctgtttgaagactggatctactggacagactggaac
actcacaccttagagagagcgcataaatataccggcgagcagcgcatcatcatggggaac
aacacccatcggccctatgacatacgagtccaccacccttacaggcagcctagaagtgag
aacccttgctcctcacatcacctgacctgcagccatctgtgcctgatcgctcctggaggt
cagcaagcttcctgcgagtgtccggatcacttcattggcatagcgttgggatttcagatc
cagtgtgtggcagactgctccagcacccagttccgctgtggagacaacgagaaatgtgtg
cctatatggtggaagtgcgacggccaatcagattgcggcgatggttcagacgaacctcag
acctgtccacctcggtactgccgcatcggccagttccagtgtcgggacgggaactgtacc
ttccccggtttcctctgcgacggacacccagactgtcctgacagctcagatgaggacgct
gccctctgcagcgatcatcgatgcgaggtgaaccagttccagtgtaaaaacaagaagtgc
atccctgtgtcctggcactgcgatggattcaccgactgctctgacggcagcgatgaggac
gcagagacttgtgctcagaagacctgccgacctggagagttcaagtgcgccaatggccgc
tgcctaccttctagctacgtgtgtgacgcccaggacgactgcggagatggatcagatgag
ccgtttgaaacctgcatgggtccagaatacaagtgtgatgaagacacagagttttcctgc
aagacaaactaccgctgtgttcctcagtgggcccgctgcgacggcacaaacgactgcttg
gacaacagcgacgaggaaggctgcgaggagctgacctgtgaccctctgggagatttccgc
tgtgacaaccaccgttgtgttcccatacgatggaagtgtgacggcgccgacgactgcggc
gatggatctgatgagagaaactgcgagccaaggtcttgcactgaaagcgagtttcgttgc
gacaacgctcaatgcatccctggaaactggcggtgcgaccatgacaacgactgcggagac
aactcggatgaacgagactgcgagctgctgacatgtcgcccgggtttcttccagtgcaac
tcgggtcactgcatccccaccgcgctgcagtgtgatggtcaggccgactgtctggattta
tctgatgagacaagctgtccaactcgctacccaggaggccgttggtgtcgtcccaatcag
ttccagtgcgcgaaccggctgtgtgtgagtccaagctgggtgtgtgacggcgtcaacgac
tgtggagatcgctccgacgaagtgctcagtctttgcttgaacgtcacctgtaagatgccg
tccaggttccgctgtgccaacggctactgcatctactcaggcctgctgtgcaacatgaag
gatgactgcggagacggcagcgatgaagacgaagtcctctgccgtgagcccaccctggcc
ccctgcacgctagaagagtttaaatgtaccaacggacactgtgtggccctggcttacgtc
tgtgaccacaacgacaactgtggggaccatacagatgaaatgggctgcaattttggccaa
gatcgaaactgcgatgagaagctctgccagcacgtttgcaccaacctggacggtaccggc
tttatctgctcctgcaggactggatataaggtggaccccgacagcacctacaactgcctc
gacatcgatgagtgtaaagagtacggtacctgtcctcaggtttgtaagaacaccaaagga
agctacgactgcgagtgttcatctggctacaggaaagtgggtgaaggaaagatgtgtgag
gctgaaggagccgctcctctgctgctgctcccggagagcgttcgcatccggaggttcaac
ctgcaggcggaaacttaccacgacttcctccaggaggaggagcgcatcatggctctggac
tatgactgggaccacaacaacactggattcagtatggtatacttcactgttgctggtaag
gactctgagcctggtgccattaagagagcatacataccttcagtggatgatggcagtaat
aacatcgctgctgctgttgacctgggtatcaaatacatcacaacaccagatggcatcgct
gtggactgggtgggcagaaacctttactgggcagattccaggctgaaaagattagaagtg
gccatgttggatggacgctacaggaagcatcttgtgaagactgatttggggtatccatct
gctgtggcggtcaaccctcggctcggaatgctgtactgggcagaccgaggagacgtagct
aagatcgagtgttcgtggttggacgggcaggagagaaaagttctagtagccgacggcctg
ggttggcccaccggcctgtccatcgacttcgccaacggagacagaatttactggtcggac
tccaaggaaagccgtattgagtctgttctgccttcaggagagcaacgcagaacagcagtt
tttatagatgtgagaaaccccttcagcgtgtgcgtgtttgaggaccacgtttactggagc
actcaggagaaaggcgagattttccggcaggacaagtttggccaaggagacaaagtgaaa
ctgttgactgctggaccttggctgactcagatctctgtgtaccagcagcagagatacaac
tccatggccataaagaatccatgcaaaggaacctgcagccacctgtgcttgatccggcct
ggaggctacacctgcgcctgtcctgagggcaccaacttcatcaccggcagcaacacagaa
tgcgacgccggttttgatccaccgcccaccatgcctccaccatgccagtgtcaaaatgga
ggcacgtgctactttgacgacaacaaggctctttgcatatgtccttctgcatggaagggt
gactactgccagaccagtgtgcacaacgtggttgcatcttcagttggaatagccattggg
gtgacggtgctggttgtggccctgctggtggctctggtttacttctgcaggaagaagtcc
aacatcatggagaggctgcagggcagcttgcccagcatgcccagcatgcccagtatgccc
agtatgccatccatgcccactttctcaggtttaaggaacggattcacccaaaatggacca
aatacagaagagaatgaatcgaggccgaacggagatacagttccctccatctcggtgtcg
atctttgacacggaggggaagagcttcgagaatccggcatatgaagctgaagggcagcct
ggctctaccagcagggtgacgcccacttccactcctgctcaaacacacaaggagaacatt
attaaccccctgtatgtggaggaaggtcaagctatgggtgacctcacaacaagttcagct
aaatctgccatttctaaggaggctgtcggtgcatttgaagaggatgttgatgttgcatca
agttcccgggtagccatggagcaaatcaaacccactcaggatgaaggttcaggcgccgtc
gtgaatcccatctacatggcatacgaacgagagtctacttctgattctgacgtttga

KEGG   Xiphophorus couchianus (Monterrey platyfish): 114154894
Entry
114154894         CDS       T05908                                 

Definition
(RefSeq) growth arrest-specific protein 1-like
  KO
K06232  growth arrest-specific 1
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:xco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    114154894
SSDB
Motif
Pfam: GDNF
Other DBs
NCBI-GeneID: 114154894
NCBI-ProteinID: XP_027890173
LinkDB
Position
12
AA seq 261 aa
MANSNLSMHGLCRAVWPLGCVLLMFGYFSVASPHHGRQLICWQAILNCKNEPGCNYAYDH
YVQACEPVLSGAKKRCPSHCISSLVQLNLTKSGPALEDCSCGEDLRCARTKRAIEPCLPR
TTSTGCTEARLQCGRDAQCSSAMQDYLHHCGKLFNGAICTNACRNVIANMRKIPKGQKLE
TCMCDGSERTICEFVKSSMKMLCVDNPDPDREYGSGQWVDLEDDDDNPDGTVEPWSRASL
PAAGRWGLTLLASILGLSPLL
NT seq 786 nt   +upstreamnt  +downstreamnt
atggcaaactccaatctttcaatgcatggtctctgcagagctgtttggcctcttggctgc
gtgcttctgatgtttggctacttctctgtggcttccccacaccacggtcggcagctgatc
tgctggcaagccatcctaaattgtaaaaacgagcccggttgcaactacgcatatgaccac
tacgtgcaggcctgcgaacctgtgctgagcggggctaagaagaggtgtcccagccactgc
atctcctcgttagttcagctcaacttgaccaaaagcggcccggctctggaggactgcagc
tgcggcgaagacttgagatgcgcacgcacaaagcgggccatcgagccgtgcctgccgagg
actaccagcacgggctgtacagaagcccggctgcagtgcgggagagacgcgcagtgcagc
tccgccatgcaggactacttgcaccactgcgggaaactttttaacggcgcgatctgcacg
aacgcctgccggaatgtgatcgcgaacatgcgtaaaatccccaagggtcagaagctagag
acgtgcatgtgcgacgggtcggagaggaccatctgtgagttcgttaagagcagcatgaag
atgctgtgcgtcgacaatccagacccagacagggaatacggcagcggacaatgggtcgac
ctggaggacgatgatgacaacccggacggcacagtggaaccgtggagcagagcctctctc
ccggctgcgggccgctggggtctgaccctgttggcttctattttgggtctatcgcccctt
ctttaa

DBGET integrated database retrieval system