KEGG   Xiphophorus couchianus (Monterrey platyfish): 114133504Help
Entry
114133504         CDS       T05908                                 

Gene name
galnt17
Definition
(RefSeq) polypeptide N-acetylgalactosaminyltransferase 17
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco00512  Mucin type O-glycan biosynthesis
xco00514  Other types of O-glycan biosynthesis
xco01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xco00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    114133504 (galnt17)
   00514 Other types of O-glycan biosynthesis
    114133504 (galnt17)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:xco01003]
    114133504 (galnt17)
Enzymes [BR:xco01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     114133504 (galnt17)
Glycosyltransferases [BR:xco01003]
 O-Glycan biosynthesis
  Mucin-type
   114133504 (galnt17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin RicinB_lectin_2
Motif
Other DBs
NCBI-GeneID: 114133504
NCBI-ProteinID: XP_027855279
LinkDB All DBs
Position
18
AA seq 635 aa AA seqDB search
MQPKITPESDSKAADKSSSHRRTAGSGFSSFPAAFRPADVTRRWRVLLLLNVLAVAGFMT
FWAKCNTRSVQAVGPEAPADGRRPRANGTAQGPSVSHEVLLKRLSSLEDVVYRQLNGLSK
SLGLIEGFGGRGKGGLPATLSPLEENDAKYLKEKYGYNAYLSDRISLDRTIPDHRPNKCR
KVSYPRDLPQISLIFIFVNEALSVILRSVHSAVNHTPAHLLKEIILVDDNSDDEQLKGPL
EDYVNKRYPGLVKIVRNQKREGLIRARIEGWKVATAEVTGFFDAHVEFTPSWAEPVLARI
KEDHKRIILPSIDNIKHDTFEVERYENSGHGYNWELWCMYINPPKQWWDEGDMSAPIRTP
AMIGCSFVANRDYFGELGLLDSGMDVYGGENIELGIRVWLCGGSMEVLPCSRVAHIARMK
KPYHSNIAFHTRRNALRVAEVWMDEYKSNVYLAWNIPMENHGIDYGDVSQRVALRKNLQC
KSFQWYLDNVYPEMRRYNNTVFYGEIRNSKVSHLCMDQGMKENHTATLHPCHGWGPQLGR
YTKEGQLFLGPLGSTGDDTRCVVDDQISSFPQLLNCDKVTNAKQKTWSFSQNDSIVNRAT
GRCLEVVPANVYFGHLLFLQPCSGQRWTIKNAMKQ
NT seq 1908 nt NT seq  +upstreamnt  +downstreamnt
atgcagcctaaaataaccccggagtcggacagcaaagcggcggataaatcgtcttctcat
cggcgcactgctggttctggtttctcaagcttccctgcggctttccgtccagctgatgtt
acccgaagatggagggtgctactgctgctcaacgtgctggcggtcgcagggttcatgacc
ttctgggccaagtgcaacacccgcagcgtgcaggcggtcggtccggaggctccggctgac
gggaggcggccccgggccaacgggacggcgcaggggcccagcgtgagccacgaggtgctg
ctgaagaggctcagctcgctggaggatgtggtgtaccgccagctaaacggtctgtccaag
tccctgggcctgatcgagggcttcggtggccgcgggaaaggcggcctgcccgccacgctt
tccccgctggaggagaacgacgccaagtacctgaaggagaagtacggctacaacgcctac
ctgagcgacaggatctctctggaccggaccatcccggaccaccggcccaacaaatgtaga
aaagtcagctacccccgagaccttcctcagatctccctcatcttcatcttcgtcaacgag
gcgctgtcggtcatcctgcgctccgtccactcggccgtcaatcacacgccggctcacctg
ctcaaagagatcatcctggtggacgacaacagcgacgacgagcagctgaagggaccgctg
gaggattacgtgaacaagcgctaccctgggctggtcaagatcgtcagaaaccagaagaga
gaaggactgatccgggccagaatcgagggctggaaggtggcgacggcggaagttaccggg
ttctttgatgcccatgtggagtttactccgtcatgggccgagccggtgttggccagaata
aaagaggaccataagaggatcatcctgccgtccatcgacaacatcaagcacgacaccttc
gaggtggagcgctacgagaactcgggccacggctacaactgggaactgtggtgcatgtac
atcaacccgcccaagcagtggtgggacgagggggacatgtccgcacccatcaggactcct
gccatgatcggctgctccttcgtggccaaccgggactactttggggaactcggcctgctg
gactcgggcatggacgtctacggaggggagaacatcgagctgggcatcagggtttggctc
tgcggcgggagcatggaggtgctgccttgctccagagtggctcacatcgctcgaatgaag
aaaccttaccacagcaacatcgcgttccacacccggcgcaacgctctgcgtgtggcagag
gtctggatggacgaatacaaatccaacgtgtacctggcctggaacatccccatggagaac
cacggcatcgactacggcgacgtttctcagagggtcgcgctgaggaagaatctgcagtgt
aagagcttccagtggtacctggacaacgtttacccggaaatgaggaggtacaataacacg
gtgttctacggtgagatccgtaactccaaagtgagccacctgtgtatggatcagggtatg
aaggaaaaccacacagccactcttcacccctgccatggctggggtcctcagttgggacgc
tacaccaaagagggtcagctgttcctgggtccgctgggcagcaccggagacgacacgcgc
tgcgtggtggacgaccagatcagcagctttccccaactcctgaactgtgacaaggtgacc
aacgccaagcagaagacgtggagcttctcccagaacgactccatcgtaaaccgggccacg
ggtcgctgtctggaggtggtgccggccaacgtttactttggccacctgctgttcctgcag
ccctgctcgggtcagaggtggaccatcaagaacgcgatgaagcaatag

DBGET integrated database retrieval system