KEGG   Xiphophorus couchianus (Monterrey platyfish): 114134115
Entry
114134115         CDS       T05908                                 

Gene name
akt1
Definition
(RefSeq) RAC-alpha serine/threonine-protein kinase
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04010  MAPK signaling pathway
xco04012  ErbB signaling pathway
xco04068  FoxO signaling pathway
xco04140  Autophagy - animal
xco04150  mTOR signaling pathway
xco04210  Apoptosis
xco04218  Cellular senescence
xco04261  Adrenergic signaling in cardiomyocytes
xco04370  VEGF signaling pathway
xco04371  Apelin signaling pathway
xco04510  Focal adhesion
xco04620  Toll-like receptor signaling pathway
xco04625  C-type lectin receptor signaling pathway
xco04910  Insulin signaling pathway
xco04914  Progesterone-mediated oocyte maturation
xco04920  Adipocytokine signaling pathway
xco05132  Salmonella infection
xco05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:xco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    114134115 (akt1)
   04012 ErbB signaling pathway
    114134115 (akt1)
   04370 VEGF signaling pathway
    114134115 (akt1)
   04371 Apelin signaling pathway
    114134115 (akt1)
   04068 FoxO signaling pathway
    114134115 (akt1)
   04150 mTOR signaling pathway
    114134115 (akt1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    114134115 (akt1)
  09143 Cell growth and death
   04210 Apoptosis
    114134115 (akt1)
   04218 Cellular senescence
    114134115 (akt1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    114134115 (akt1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    114134115 (akt1)
   04625 C-type lectin receptor signaling pathway
    114134115 (akt1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    114134115 (akt1)
   04920 Adipocytokine signaling pathway
    114134115 (akt1)
   04914 Progesterone-mediated oocyte maturation
    114134115 (akt1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    114134115 (akt1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    114134115 (akt1)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    114134115 (akt1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:xco01001]
    114134115 (akt1)
Enzymes [BR:xco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     114134115 (akt1)
Protein kinases [BR:xco01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   114134115 (akt1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Kinase-like Pkinase_C PH_11 Pkinase_fungal Seadorna_VP7
Other DBs
NCBI-GeneID: 114134115
NCBI-ProteinID: XP_027856235
LinkDB
Position
19
AA seq 473 aa
MTNVVIVKEGWLHKRGEYIKTWRPRYFLLKSDGTFIGYKERPQDVDQLETPLNNFSVAQC
QLMKTERPKPNTFIIRCLQWTTVIERTFHVETPEEREEWTKAIQAVAEGLHKQEEERMDS
SPEPMDMEVYLTKPRQKVTMHDFEYLKLLGKGTFGKVILVKEKATGRYYAMKILKKEVIV
AKDEVAHTLTENRVLQNSKHPFLTGLKYSFQTHDRLCFVMEYANGGELFFHLSRDRVFSE
ERARFYGAEIVSALDYLHAERNVVYRDLKLENLMLDKDGHIKITDFGLCKEGIKDGATMK
TFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFELILMEDIR
FPRTLGPEARSLLSGLLKKDPMQRLGGGPDDAKEIMQHKFFAGINWQDVYEKKLVPPFKP
QVTSETDTRYFDEEFTGQIITITPPGQDDSMESFDSEQRPHFPQFSYSASGTA
NT seq 1422 nt   +upstreamnt  +downstreamnt
atgaccaatgtggtgatcgtcaaggagggatggctgcataaaagaggagaatacatcaag
acctggaggccgaggtattttctcctcaagagtgacggtacattcatcggttacaaagaa
cgaccacaagatgttgaccagctggaaacccccttaaataacttctctgttgcacagtgc
cagctgatgaagacggaacgacccaagcccaacacatttatcatccgctgcctgcagtgg
accactgtcatcgagcgtaccttccacgtggagacccccgaggaaagggaagaatggacc
aaagccatccaggcagtggctgaaggccttcataaacaagaagaggagaggatggactcc
tctccagagcccatggacatggaggtctacctgaccaaacccagacagaaagtgactatg
catgactttgaatacctcaaactcctgggaaaaggcacttttggcaaagttattctggta
aaggagaaggccacaggacgctactatgccatgaagatcctaaagaaggaggtgatcgta
gcaaaagatgaagtggcacacacactcacagaaaacagggtcctccagaattcaaagcat
ccgttcttgactggactgaaatactccttccagactcatgaccgcctgtgttttgtaatg
gagtacgcaaacggtggtgaacttttcttccatctgtcaagagaccgggtattttcagaa
gaacgggctcggttctatggtgcagagatagtgtcagcgctggattacctacatgctgag
agaaacgtggtttatagagatctgaagctggaaaacctcatgctggataaagacggacac
ataaagatcacagattttggtctctgtaaggaagggatcaaagacggagccactatgaaa
actttctgcgggacgccagagtacctcgcacctgaggtcctagaagacaatgactacggc
cgcgctgtggactggtggggtctgggcgtggtgatgtatgagatgatgtgcggccggctg
ccgttttacaaccaggatcacgagaggctgtttgagctcatcctcatggaagacatccgt
tttcctcggactctcggccctgaggcgcgctcgctgctttccggtctccttaagaaggac
cctatgcaaaggttaggtggagggcctgatgatgccaaggaaatcatgcagcacaaattc
tttgctgggataaattggcaagatgtctatgagaagaagcttgtcccgccgtttaagccc
caagttacctcagagacggacacaagatattttgacgaagagttcacaggacaaatcatc
accattacgccacccggacaagatgacagcatggaatctttcgacagcgagcaacgaccc
cacttcccacagttctcctactctgccagtgggacagcctaa

KEGG   Xiphophorus couchianus (Monterrey platyfish): 114137948
Entry
114137948         CDS       T05908                                 

Definition
(RefSeq) RAC-gamma serine/threonine-protein kinase
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04010  MAPK signaling pathway
xco04012  ErbB signaling pathway
xco04068  FoxO signaling pathway
xco04140  Autophagy - animal
xco04150  mTOR signaling pathway
xco04210  Apoptosis
xco04218  Cellular senescence
xco04261  Adrenergic signaling in cardiomyocytes
xco04370  VEGF signaling pathway
xco04371  Apelin signaling pathway
xco04510  Focal adhesion
xco04620  Toll-like receptor signaling pathway
xco04625  C-type lectin receptor signaling pathway
xco04910  Insulin signaling pathway
xco04914  Progesterone-mediated oocyte maturation
xco04920  Adipocytokine signaling pathway
xco05132  Salmonella infection
xco05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:xco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    114137948
   04012 ErbB signaling pathway
    114137948
   04370 VEGF signaling pathway
    114137948
   04371 Apelin signaling pathway
    114137948
   04068 FoxO signaling pathway
    114137948
   04150 mTOR signaling pathway
    114137948
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    114137948
  09143 Cell growth and death
   04210 Apoptosis
    114137948
   04218 Cellular senescence
    114137948
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    114137948
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    114137948
   04625 C-type lectin receptor signaling pathway
    114137948
  09152 Endocrine system
   04910 Insulin signaling pathway
    114137948
   04920 Adipocytokine signaling pathway
    114137948
   04914 Progesterone-mediated oocyte maturation
    114137948
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    114137948
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    114137948
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    114137948
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:xco01001]
    114137948
Enzymes [BR:xco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     114137948
Protein kinases [BR:xco01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   114137948
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Pkinase_C Kinase-like
Other DBs
NCBI-GeneID: 114137948
NCBI-ProteinID: XP_027862626
LinkDB
Position
22
AA seq 479 aa
MSDVTIVREGWLQKRGEYIKNWRPRYFLLKTDGSFIGYKEKPQDADLPYPLNNFSVAKCQ
LMKTERPKPNTFIIRCLQWTTVIERTFHVDSPDERDEWTEAIQMVADKLQRQEEERIQCS
PTSNIDNMVEEEMDVSTTHHKRKTMSDFDYLKLLGKGTFGKVILVREKASGKYYAMKILK
KEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHLSRE
RVFSEERTRFYGAEIVSALNYLHSAKIVYRDLKLENLMLDKDGHIKITDFGLCKEGITDA
ATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVTYEMMCGRLPFYNQDHEKLFELILM
EDIKFPRTLSADAKSLLSGLLIKDPNKRLGGGPEDAKEIMRHSFFSGIDWQDVYDKKLVP
PFKPQVTSETDTRYFDEEFTAQTITITPPEKFDEDGMDCLDNERRPHFPQFSYSASGRE
NT seq 1440 nt   +upstreamnt  +downstreamnt
atgagcgatgtcaccatcgttagagagggatggctccagaaaaggggtgaatacataaag
aactggcggccacgttacttcctgctgaagacagacggctccttcatcggctacaaagag
aaacctcaggatgcagacctcccttatcctctaaataacttttcagtagcaaaatgccag
ctgatgaagacagagaggccgaagccaaacaccttcatcatacgctgccttcagtggacc
actgtcattgaaaggaccttccatgtggattcgcctgatgaacgagatgagtggacagag
gctatccagatggtggcagacaagctgcagagacaagaggaggagaggatccagtgcagc
cccacttccaatattgacaacatggtggaggaggaaatggacgtctccactacacaccac
aaacgcaagacgatgagtgactttgactacctgaagctgctgggaaagggaacgtttggt
aaagtcatccttgtccgggaaaaggccagcgggaagtattacgccatgaaaatccttaaa
aaagaagtcatcatagccaaggatgaagttgctcacacactcacagagagcagagtattg
aaaaacaccaggcatccttttctcacttcgctgaagtattcattccagactaaagaccgt
ctctgctttgtcatggagtacgtgaatggaggggagctgtttttccatttgtccagagag
cgagtgttctccgaggagcgcacgcgcttctacggcgccgagattgtctcagctctcaac
tacctgcattcagccaagattgtgtaccgggacctcaagttggaaaacctgatgctggat
aaagatggtcatataaaaatcacagattttggactctgcaaggagggcatcactgatgct
gctacaatgaagaccttctgtggaacgccagagtacctcgctccagaggtcctggaggac
aacgattacggccgagccgtggactggtgggggctgggcgtggtgacgtacgagatgatg
tgcggccggctgccgttctacaaccaggaccacgagaagctgttcgagctcatcctcatg
gaggacatcaagttcccgcgcacgctgtcggctgacgccaagtcgctgctgtccggcctg
ctcatcaaagacccaaacaaaaggctcgggggcggaccagaagatgctaaggaaataatg
aggcacagtttcttctctggcatcgactggcaggatgtttacgacaaaaagctcgtccct
cccttcaagcctcaggtgacgtcggagacagacaccaggtacttcgacgaggagttcaca
gctcaaaccatcacaatcactccaccagagaaattcgatgaggatggaatggactgtctg
gacaacgagaggcgaccgcacttcccgcagttctcgtactcggccagcgggcgagaatga

KEGG   Xiphophorus couchianus (Monterrey platyfish): 114144319
Entry
114144319         CDS       T05908                                 

Definition
(RefSeq) RAC-gamma serine/threonine-protein kinase-like
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04010  MAPK signaling pathway
xco04012  ErbB signaling pathway
xco04068  FoxO signaling pathway
xco04140  Autophagy - animal
xco04150  mTOR signaling pathway
xco04210  Apoptosis
xco04218  Cellular senescence
xco04261  Adrenergic signaling in cardiomyocytes
xco04370  VEGF signaling pathway
xco04371  Apelin signaling pathway
xco04510  Focal adhesion
xco04620  Toll-like receptor signaling pathway
xco04625  C-type lectin receptor signaling pathway
xco04910  Insulin signaling pathway
xco04914  Progesterone-mediated oocyte maturation
xco04920  Adipocytokine signaling pathway
xco05132  Salmonella infection
xco05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:xco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    114144319
   04012 ErbB signaling pathway
    114144319
   04370 VEGF signaling pathway
    114144319
   04371 Apelin signaling pathway
    114144319
   04068 FoxO signaling pathway
    114144319
   04150 mTOR signaling pathway
    114144319
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    114144319
  09143 Cell growth and death
   04210 Apoptosis
    114144319
   04218 Cellular senescence
    114144319
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    114144319
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    114144319
   04625 C-type lectin receptor signaling pathway
    114144319
  09152 Endocrine system
   04910 Insulin signaling pathway
    114144319
   04920 Adipocytokine signaling pathway
    114144319
   04914 Progesterone-mediated oocyte maturation
    114144319
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    114144319
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    114144319
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    114144319
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:xco01001]
    114144319
Enzymes [BR:xco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     114144319
Protein kinases [BR:xco01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   114144319
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Pkinase_C Kinase-like
Other DBs
NCBI-GeneID: 114144319
NCBI-ProteinID: XP_027872811
LinkDB
Position
5
AA seq 479 aa
MSDQNVVKEGWVQKRGEYIKNWRPRYFLLKADGSFIGYKDKPQDSDLAYPLNNFSVAKCQ
LMKTERPKPNTFIIRCLQWTTVIERTFHVDTPDERDEWAEAIQMVAESLAKQEEEGILCS
PTSQIENVNEEEMDTSISHYKRKTMNDFDYLKLLGKGTFGKVILVREKASGTYYAMKILK
KEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHLSRE
RVFSEDRTRFYGAEIVSALDYLHSAKIVYRDLKLENLMLDKDGHIKITDFGLCKEGITDT
ATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVTYEMMCGRLPFYNQDHEKLFELILM
EEIKFPRTLSADAKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFGTIDWQDVYDKKLVP
PFQPQVSSETDTRYFDEEFTAQTITITPPEKYDEDGMDAADNERRPHFPQFSYSASGRE
NT seq 1440 nt   +upstreamnt  +downstreamnt
atgagcgaccagaacgtcgtcaaggaaggctgggtccaaaaaagaggcgaatacatcaag
aactggcgaccacgttacttcctgctcaaggcagatggctccttcatcggctacaaggac
aaaccgcaggactcggacctggcctatccgctcaacaacttctctgtagcaaaatgtcag
ttgatgaagacagaacgacccaaaccaaacaccttcatcatccgctgtctgcagtggacc
accgtcatcgagaggacttttcatgtcgacactcctgatgagagggacgagtgggccgag
gccatccagatggttgcagaatcgctggctaaacaggaggaggaaggcatcctgtgcagc
cccacttcccagattgagaacgttaatgaggaggagatggacacgtccatcagccactac
aaacgaaagacaatgaatgactttgactatctgaagcttctgggcaaaggcacgtttgga
aaagtcattctggtgagggagaaggcgagcggcacctactatgccatgaagatcctgaag
aaggaagtcattatagccaaggatgaagttgctcatacgctcacggaaagtagagtatta
aaaaatactcggcatccattcctaacatctttgaagtactcattccagaccaaggatcgg
ctttgctttgtaatggaatacgtcaatggaggagagctgtttttccacttgtctagagag
agggtgttttcagaggaccgcactcgtttttacggcgccgagattgtttctgctttagac
taccttcattctgccaagatcgtctaccgtgacctcaagctggaaaacctcatgttagac
aaagatggccacatcaagatcacagattttggcctgtgtaaagaagggattaccgacact
gcgaccatgaagaccttctgtggaacaccggagtacctcgctcctgaggttctggaggac
aacgactatgggcgagcggtggactggtggggtctgggcgtagttacgtatgagatgatg
tgcggccgacttccgttctacaaccaggaccacgagaagctgtttgagctcatcctgatg
gaggagatcaagtttccacggactctgtctgctgatgccaagtcactgctgtcagggctg
ctgatcaaggaccccaacaaacggctgggcggcgggccggatgacgctaaggagattatg
aggcacagcttcttcggcacaatcgattggcaggacgtgtacgacaagaagctggtcccc
cccttccagccgcaggtctcctcagagacggacacgcgctactttgacgaagagttcaca
gcacagaccatcaccatcactccgccagaaaaatatgacgaggacgggatggacgcagcg
gacaacgagcgacggcctcatttcccacaattctcctactcagccagcgggcgggagtga

KEGG   Xiphophorus couchianus (Monterrey platyfish): 114161603
Entry
114161603         CDS       T05908                                 

Definition
(RefSeq) RAC-beta serine/threonine-protein kinase
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04010  MAPK signaling pathway
xco04012  ErbB signaling pathway
xco04068  FoxO signaling pathway
xco04140  Autophagy - animal
xco04150  mTOR signaling pathway
xco04210  Apoptosis
xco04218  Cellular senescence
xco04261  Adrenergic signaling in cardiomyocytes
xco04370  VEGF signaling pathway
xco04371  Apelin signaling pathway
xco04510  Focal adhesion
xco04620  Toll-like receptor signaling pathway
xco04625  C-type lectin receptor signaling pathway
xco04910  Insulin signaling pathway
xco04914  Progesterone-mediated oocyte maturation
xco04920  Adipocytokine signaling pathway
xco05132  Salmonella infection
xco05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:xco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    114161603
   04012 ErbB signaling pathway
    114161603
   04370 VEGF signaling pathway
    114161603
   04371 Apelin signaling pathway
    114161603
   04068 FoxO signaling pathway
    114161603
   04150 mTOR signaling pathway
    114161603
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    114161603
  09143 Cell growth and death
   04210 Apoptosis
    114161603
   04218 Cellular senescence
    114161603
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    114161603
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    114161603
   04625 C-type lectin receptor signaling pathway
    114161603
  09152 Endocrine system
   04910 Insulin signaling pathway
    114161603
   04920 Adipocytokine signaling pathway
    114161603
   04914 Progesterone-mediated oocyte maturation
    114161603
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    114161603
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    114161603
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    114161603
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:xco01001]
    114161603
Enzymes [BR:xco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     114161603
Protein kinases [BR:xco01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   114161603
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Kinase-like Pkinase_C PH_11
Other DBs
NCBI-GeneID: 114161603
NCBI-ProteinID: XP_027900770
LinkDB
Position
18
AA seq 482 aa
MDEVTVVKEGWLHKRGEYIKTWRPRYFILKSDGSFIGYKDKPEVSSDLSLPPLNNFSVAE
CQLMKTERPKPNTFVIRCLQWTTVIERTFHVETNSEREEWMQVIQTVANSLKSQQQDEEP
MEIKFGSPSDSSGAEEMEIAMCKSRSKVTMSDFDYLKLLGKGTFGKVILVKEKATGMYYA
MKILRKEVIIAKDEVAHTVTESRVLQNTRHPFLTTLKYAFQTHDRLCFVMEYANGGELFF
HLSRDRIFTEDRARFYGAEIVSALEYLHSRNVVYRDLKLENLMLDKDGHIKITDFGLCKE
GITDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLF
ELILMEEIRFPKTLAPEGKALLAGLLKKDPKQRLGGGPDDAKDVMTHKFFALINWQDVIE
KKLIPPFKPQVTSETDTRYFDDEFTAQSITITPPDKYDSLDVEDSDQRTHFPQFSYSASI
RE
NT seq 1449 nt   +upstreamnt  +downstreamnt
atggatgaagtcactgttgttaaagaaggatggctccacaagagaggtgaatacatcaaa
acatggcgacctcgctacttcatcctgaagagcgatggatcctttatcggatacaaagac
aagccggaggtgtccagtgacctcagcctcccaccgctcaacaacttctccgtcgcagag
tgccagctgatgaagacggagcgccccaagcccaacacatttgtaattcgatgtctgcag
tggaccaccgttatagagcggactttccatgtggagaccaacagcgagagggaggaatgg
atgcaggtgatccagacagtagcaaacagcctgaagagtcagcagcaggatgaggagccc
atggagatcaaatttggctcacccagcgacagcagcggcgcagaggagatggaaattgct
atgtgcaaatcccgttcaaaagtgactatgagtgactttgactacctgaagctgctgggc
aaagggacgtttggaaaagtgatcttggttaaggagaaagctacagggatgtactatgcc
atgaaaatcctccgcaaagaagtcatcattgctaaagatgaggtggctcacacagttaca
gagagcagagttctccaaaacacacggcatccttttctaacgacactaaaatatgcattt
caaacacacgaccggctatgcttcgtgatggagtatgcaaatggaggagaactcttcttt
cacttatcccgggacagaatattcacagaagatagagcacggttctatggtgcagaaata
gtatcagcactggagtatctacactcacgcaatgttgtttacagggacttaaagctggag
aacctgatgttggacaaagacggccacataaagataacagactttgggctgtgtaaggag
ggaattacagacggtgccaccatgaaaaccttctgtggaactccagagtacctggcgcca
gaggtactggaggacaacgactatggccgtgccgtggactggtggggactgggagtggtg
atgtatgagatgatgtgtggccggttaccgttctacaaccaggaccacgagcgtctgttt
gagctcatcctcatggaggagatccgcttcccgaagaccctggcaccggagggcaaggcc
ctgctggcaggcctgctgaaaaaagatcccaaacaaaggcttggaggtggaccagacgat
gccaaagatgtaatgacccacaagttctttgccttgataaactggcaggacgtgattgaa
aaaaaacttatcccacccttcaagccccaagtaacatcagagacagacacccgttacttc
gatgatgagttcacagcacaatctattacaataactcctccagacaagtatgacagctta
gatgttgaggattcagatcagcgtacacacttccctcagttctcatactctgccagcata
cgggaatga

DBGET integrated database retrieval system