KEGG   Xiphophorus couchianus (Monterrey platyfish): 114134500
Entry
114134500         CDS       T05908                                 

Gene name
sos2
Definition
(RefSeq) son of sevenless homolog 2 isoform X1
  KO
K03099  son of sevenless
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04010  MAPK signaling pathway
xco04012  ErbB signaling pathway
xco04068  FoxO signaling pathway
xco04150  mTOR signaling pathway
xco04510  Focal adhesion
xco04540  Gap junction
xco04810  Regulation of actin cytoskeleton
xco04910  Insulin signaling pathway
xco04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:xco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    114134500 (sos2)
   04012 ErbB signaling pathway
    114134500 (sos2)
   04068 FoxO signaling pathway
    114134500 (sos2)
   04150 mTOR signaling pathway
    114134500 (sos2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    114134500 (sos2)
   04540 Gap junction
    114134500 (sos2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    114134500 (sos2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    114134500 (sos2)
   04912 GnRH signaling pathway
    114134500 (sos2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:xco04990]
    114134500 (sos2)
Domain-containing proteins not elsewhere classified [BR:xco04990]
 Pleckstrin homology (PH) domain-containing proteins
  Dbl-Like RhoGEF family proteins
   114134500 (sos2)
SSDB
Motif
Pfam: RasGEF RasGEF_N RhoGEF Histone PH Thy1 Sec3-PIP2_bind
Other DBs
NCBI-GeneID: 114134500
NCBI-ProteinID: XP_027856943
LinkDB
Position
19
AA seq 1324 aa
MQPQQMYDFSSEENSHKWRGLFVQALKKVQEQVHPTLKAKEDALQHIEELILQLLNMLCV
AQPRTVQDVEERVQKTFPHPIDKWAINDAQAAIEKRKRRSPLLLPVDKIHPLLKEVLGYK
VDYHVSLYIVAVLEYISADILKLAGNYVGNIRHYEITQQDIKVSMCADKVLMDMFDQEED
IGVMSQFTEEPLSLSELSYDELVKLEIAEERQYLRELDLIIKVFRNHFLSHPKVFTDEDV
EVIFSNILDIHELTVKLLGLIEDAVEMTADGSPHPLVGSCFEDLAEEQAFDPYETLSQDI
LGKKFNEHFHEMMQRQTVRQHFGSNPGGFKECVQYVLPQLMKVPVYHCLHYFELLQQLQE
RSKEQDDRECLKQAITALLNLQSSVERIYVKHQPRRKPVEAIYRRYSRQVRGKQLAIKRM
IEIQKSIDGWEGKDIGQCCNEFITEGTLIRAGAKHERHNFLFDGLMISCKANQSSRLPGS
GSGAEYRLKEKFVLRKIRIVDREDSQELQHAFELIFKDENSAVFCARTAEEKANWMAALM
ALQYRSTLDRMLDSILQTEEQQRPLRLPSPEVYQFAVQDSEENIVFEDRVQSKTGIPIIK
AGTVVKLIERLTYHMYADPNFVRTFLTTYRSFCKPQELLTLLIDRINIPESGNGDDEVAI
WNGDPPTTAELQRFRREYVQPVQLRVLNVFRQWVEHHFYDFENNPDLRVQLEEYITKKLQ
LRGKSMRKWVESINKVIRRKLQIQSNGVSHNITFESSPPPFEWHICKAGQIENFELMTLH
PIEIARQLTLIESELYRAVRPSELVGSVWTKEDREKNSPNLLRMIRHTTNLTLWFEKCIV
EMMNHEERVAVLSRVIEILQVFQELNNFNGVLEVVSAINSVPVYRLDHTFEAIPERKKKI
LEEAVELSQDHFKKYLAKLKSINPPCVPFFGIYLTNILKTEEGNPDFLRRHGKDLINFSK
RRKVAEITGEIQQYQNQPYCLKVEQDIRKYFENLNPMENMSEKEFSDYLFKKSLEIEPRN
ARQPARFPRKTTYSLKSPGLRPVRTSTSGTLKGHPVALERDLQHKITFRSIAENDQDPPS
SASVPTSPNTPTPPPSASSDLGPVFDHDLNSSYGSSMFPCLLNPSKLQSVSCGSLHQLGE
EPKPPPLPPRRKDTVSEAKQSSMCDSPPAIPPRLPPLPRNQHRSPLYNGPHYDGPLPSPP
PPPPRDPLPDTPPPVPLRPPEIFINYPQPSPGPGVARYNWDLNSSPSSPNTPPSTPSPRV
PRRGCPLSASQNSLCPLPTAAPPVPPRHNPVPQLPKLPPKTYKREALQPPLQSLPLVENT
DGSQ
NT seq 3975 nt   +upstreamnt  +downstreamnt
atgcagccccagcagatgtacgacttttcgagtgaagagaacagtcacaagtggagaggc
ctcttcgtgcaagctctaaaaaaggtacaggagcaggtccacccaaccctgaaagcaaag
gaggatgccctgcagcacattgaagagctgatcctgcagctgctcaacatgctgtgtgtg
gcccagcctcgcacagtgcaggatgtagaggaacgtgtgcagaaaacctttccccaccct
atagataagtgggcaattaacgacgcccaggcagctattgagaaacgtaagagaagaagc
cccttgcttctccctgtggacaaaatacacccattgcttaaggaggttcttggctacaag
gtggactaccatgtgtccctgtacatcgtggcagtacttgaatacatatcagcagatata
ctcaaactggccggcaactacgtcggcaacattcggcactatgaaatcacccaacaggac
atcaaggtctccatgtgtgcagacaaggtgttgatggacatgttcgaccaggaggaggac
atcggcgtgatgtcgcagttcaccgaggagcctttgtcgctctcggagctttcgtatgat
gaactggtgaagcttgaaattgcagaggagcggcagtatctgcgggagctcgatctgatt
attaaagtgttccggaaccatttcctgtcccaccccaaagtcttcacagatgaggatgtc
gaggtgatcttcagcaacatcttggacatccacgagctgaccgtgaagcttctgggtctg
atcgaggacgcggtggagatgactgctgacggcagtcctcatccgctggtgggcagctgc
tttgaagacctagcagaggagcaggcgtttgacccgtacgagaccctgtctcaggacatt
cttggcaagaaattcaatgagcacttccatgaaatgatgcagaggcaaacagttcgccaa
cactttgggtctaatccgggaggctttaaggagtgcgttcagtatgtccttccccagctg
atgaaggttccagtgtaccactgtctgcactactttgagctactgcagcaacttcaggaa
cgtagcaaagaacaagatgacagagaatgtctgaaacaggcgattactgccttgcttaac
ctgcagtccagcgtggagcgcatctacgtcaagcaccagcctcgtcgtaaacctgtcgag
gccatttaccgccgctacagccggcaggtacgtggcaagcagctagccatcaagcgaatg
atcgagatccagaaaagcatcgacggctgggaggggaaagacatcggccagtgctgcaac
gagttcatcaccgaggggacgctcatacgagccggcgccaagcacgagagacacaacttc
ctgtttgacggcctcatgatcagctgcaaggccaatcagagctcgcggctgccggggtcc
ggcagtggcgcggagtaccgcctcaaagagaagtttgtgctgcgaaagatccgcatcgtg
gaccgcgaggactcccaggagctgcagcacgctttcgaactcattttcaaagacgaaaac
tctgcggttttctgcgcacggacagcggaggagaaggcgaactggatggcggcgctgatg
gcgcttcagtaccgctccacgctagaccgcatgttggactccatactgcagacggaggag
cagcagcgtccgctcaggctgccctcgccagaggtctaccagttcgccgtgcaggactca
gaggagaacattgtgttcgaggacagagtgcagagcaagaccggcatccccatcatcaag
gccggcaccgtggtcaagctcatcgagaggctcacctaccacatgtatgctgatcccaac
tttgtgcgcacatttctcaccacctaccgatcattctgcaaaccacaggagctgctcacc
cttcttatagacaggattaatatccccgagtcagggaatggcgacgacgaagtggctatc
tggaacggcgatccgccaacgacggccgaactccagcggttccgaagggagtatgtgcag
ccggtccaactcagggtcctcaacgtttttcgccagtgggtcgaacatcatttctacgac
tttgagaacaatccagacctgagagttcagctggaggaatacatcaccaaaaaactgcaa
ctgcgaggcaagtctatgagaaagtgggtggagtccataaataaggtgatcaggcggaag
cttcaaatccagtcgaacggcgtcagtcacaacatcacctttgagagctcgcctcctccc
ttcgagtggcacatctgcaaagccggccagatcgagaactttgaactcatgacccttcac
cccatagagatcgcccgccagctcactctgatcgagtctgagctctacagagccgtccgg
ccgtcagaactagtgggcagcgtctggaccaaagaggacagagagaagaactctccaaac
ttgctccgcatgatccgccacaccaccaacctcacgctgtggtttgagaaatgtatcgta
gagatgatgaaccacgaggaaagggtcgccgtgttgtcgcgggtcatcgagatcctgcag
gttttccaggagctcaacaacttcaacggagtgctggaggtggtcagcgccatcaactct
gtcccggtctacaggttggaccacaccttcgaggcaataccagaaaggaaaaagaaaatc
ttggaagaagcggtggaactgagccaggatcattttaagaagtacttggctaaactaaag
tcaataaacccaccctgtgtacctttctttggcatctatttaaccaacatcctgaagacg
gaggaaggcaaccccgacttcctgcgacgtcacggcaaagacctgatcaacttcagcaag
cgacggaaagtggccgaaataacaggagagatccagcagtaccagaaccagccctactgc
ctgaaggtggagcaagacatcaggaagtactttgagaacctgaatccgatggagaacatg
agtgagaaggagttttcagactacctgttcaaaaagtctctggaaattgagccccggaac
gccaggcagcctgcgcgatttcccaggaagaccacgtactccctgaagtcccctgggctc
cggcccgtgcgaacgtctacctctggcaccctgaagggccacccggtggccctggagcgg
gacctgcagcataagatcactttccgcagcatcgctgagaacgaccaggaccccccgtct
tccgcctcggtgcccacctctccgaacacgcccaccccgccgccgtcggcctcctcggat
ctcggcccggtcttcgaccacgacctcaacagctcctacggcagctctatgttcccctgt
cttctgaacccgtcaaagttacagtccgtctcctgtggcagcctccaccagcttggagag
gaacccaagccgcctcctttgcctcctcggaggaaagacaccgtgtctgaagccaaacag
agctccatgtgcgacagcccccccgccatccctccgcggctccccccgctgccgaggaac
cagcaccggtctccgctctacaacggcccccactatgacggacccctgcccagcccgccg
cctccgccgccccgggacccgcttcccgacacgcccccgccggtgcccctgcggcctccg
gagatcttcatcaactacccgcagccgtcgcctggcccgggcgtggcccgctacaactgg
gacctgaacagctcgcccagctcgcccaacacgccgcccagcacgccgtcgccgcgcgtt
ccccggcggggctgccccctcagcgccagccagaacagcctctgtccgctccccaccgcc
gccccgcccgtgcccccgcgtcacaaccccgtcccgcagctccccaagctcccgccaaag
acatataagcgggaggccctgcagccgccgctgcagagcctcccattggtggagaacacc
gacggcagccagtga

KEGG   Xiphophorus couchianus (Monterrey platyfish): 114145177
Entry
114145177         CDS       T05908                                 

Gene name
sos1
Definition
(RefSeq) son of sevenless homolog 1 isoform X1
  KO
K03099  son of sevenless
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04010  MAPK signaling pathway
xco04012  ErbB signaling pathway
xco04068  FoxO signaling pathway
xco04150  mTOR signaling pathway
xco04510  Focal adhesion
xco04540  Gap junction
xco04810  Regulation of actin cytoskeleton
xco04910  Insulin signaling pathway
xco04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:xco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    114145177 (sos1)
   04012 ErbB signaling pathway
    114145177 (sos1)
   04068 FoxO signaling pathway
    114145177 (sos1)
   04150 mTOR signaling pathway
    114145177 (sos1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    114145177 (sos1)
   04540 Gap junction
    114145177 (sos1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    114145177 (sos1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    114145177 (sos1)
   04912 GnRH signaling pathway
    114145177 (sos1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:xco04990]
    114145177 (sos1)
Domain-containing proteins not elsewhere classified [BR:xco04990]
 Pleckstrin homology (PH) domain-containing proteins
  Dbl-Like RhoGEF family proteins
   114145177 (sos1)
SSDB
Motif
Pfam: RasGEF RasGEF_N Histone RhoGEF PH DIX
Other DBs
NCBI-GeneID: 114145177
NCBI-ProteinID: XP_027874431
LinkDB
Position
5
AA seq 1344 aa
MVLIRVLRRDESGQSERLPVRFGEAPEVCVAPAFTNLLGTKAGSEVLYQVHPNLKSQQEA
LQYIEDLILQLLSMLCQAQPRTVQDVEERVQRSFPHPIDKWAIADALAAIEKKKRKNPLA
LPVDKIHPLLKEVLGYKLDHQVCVYMVAVLEYISADILKLAGNYVRNIRHDDITKQDITV
AMCADKVLMDMFHQDEEDMGLFPLLDEEPSANEEQRYCDLVRSFLADGHQYLRQLHLLLK
VFREPFASCPTLFSTQDVDSIFGRLADIQEVTVKLLGLLEDTVEMTDEGSPHPLVGSCFE
DLAEELAFDPYEAYAQEVLHPAFHDHFLDLVTKPGASVHLQSICEGFKEAVRYVLPRLLL
TPVYHCLHLLDTLKQLEERSEDEEDKECLRQAITALLNLQSSLERICSRSLAKRRLSEPA
CRLHSQQVKSKHLAIRRMKDVQRSIDGWEGADIVQCCNEFIMEGTLSRVGAKHERHIFLF
DGLMISCKAGHAPPRLPGAAAAEFRLKEKFLMRKVRVVDREDRDGEWRHAFEVAPKDGCG
VLFAAKSAEEKNGWMAALVSLQYRGTLERMLDQALLQDEEQQMRLPSVQRYRFAEPDSDQ
NVVFEDSVQSKSGIPVIKAGTVLKLIERLTFHLYADPNFVRTFLTTYRSFCRPGELLDLL
VERFDIPEPAPAESDPTDGLEQLLSADLKRFRKEFVQPVQLRVLNVCRHWVEHHFYDFER
DPGLLSRLEDFIASVRGKAMRKWVESITKIIQRKQQVQVSQASPPPSITFQNSPPPIEWH
LCRQGAVETFDLMTLHPIEIARQLTLLESDFYRAVRPSELVGSVWTKEDKELHSPNLLRM
IRHTTNLTLWLEKCIVETENLEERVAVVSRIIEILQVFQELNNFNGVLEVVSAMNSSPVY
RLDHTFEQIPSRQRKILEEAHELSEDHYKKYLAKLRSINPPCVPFFGIYLTNILKTEEGN
PDFLRRHGKDLINFSKRRKVAEITGEIQQYQNQPYCLSVEPDIRKFLENLNPMEDLSEKD
FADHLFNKSLEIEPRNTRSLPRFVKRYTCPLKSPGIRPTSARVGSMRHPTPLQNEPRKIS
YNRVTDSESEGGVISAPNSPRTPLTPPPASAASSSTDVGSVFDSPQGPSSPFHSTCDSIF
AVISLPHGPRSSSVSSMVSFSRTSEDAAIPPPVPPRRRPESAPSESSPTKVQSALESPPA
VPPRQPTCKLLPPRYSSLSSSPPDSPPLLPPREPLSSPLHLLPPPQGRSRCEVLSQAFFP
SSSSSSLSSAPAPLTSSPPLTPTGRKMPFPSPPLDGPPVPPRHSVPKLPPKTYKRESLSN
VPPAGHAPCSVVGHLVKEAELETL
NT seq 4035 nt   +upstreamnt  +downstreamnt
atggttctgatccgggtcctgaggcgagatgaatcgggtcagagtgaacgcttgccagtc
cgattcggagaagcaccggaagtttgtgttgctccagcctttactaaccttctggggacc
aaagccgggtcagaggtgttgtaccaagtgcatcctaacctgaagtcccagcaggaggcg
ctgcagtacatcgaggacctgatcctgcagctgctcagcatgctgtgtcaggctcagccg
cgcacagtgcaggacgtggaggagcgggtccagaggagttttcctcaccccatcgataag
tgggcaatcgccgatgctctggccgccatcgagaagaagaagaggaagaacccgctggca
cttcctgttgacaagatccaccccctgctcaaggaggtgctgggctataaactcgaccat
caggtctgcgtctacatggttgccgttctggagtatatctcggcagacatcttgaagctg
gcggggaattacgtcaggaacatccgccatgatgacatcaccaagcaggacatcactgtg
gcgatgtgcgccgacaaggttctgatggacatgttccaccaggacgaggaggacatgggt
ctgttcccgctgctggacgaggagccgtcggccaatgaggagcagcgatactgtgacctg
gtccggagcttcctggctgacggacaccagtacctgaggcagctgcacctgctgctcaag
gtgttcagggagcccttcgcctcctgccccaccctcttctccacacaggacgtggacagc
atctttggccgcctggcggacatccaggaagtgacggtgaagctgctgggcctgctggag
gacacggtggagatgacagacgagggcagcccccacccgctggtgggcagctgctttgag
gacctggcagaggagttggcctttgacccctatgaggcgtatgctcaggaagtcctgcat
cctgccttccacgatcacttcctggatttagtgaccaaacctggagcctctgtccatctg
cagtccatctgcgagggatttaaagaagccgtccgctacgtcctgcccaggctgctgctg
acccccgtctaccactgcctccacctgctggacacactcaagcaactggaggagcgcagc
gaggatgaggaggataaggagtgtcttcgtcaggccatcacggcgctgctgaacctgcag
agcagcttggagaggatttgctccaggagcctggccaagcggaggctcagcgaaccggcc
tgccggctccacagccagcaagtaaagagtaagcacctggccatcaggaggatgaaggac
gtccagcggagcatcgacggctgggagggggcggacatcgtccagtgctgtaacgagttc
atcatggagggcacgttgagccgcgtcggtgccaagcacgagcgccacatcttcctgttc
gacggtctgatgatcagttgcaaggctggccacgcgccgccgcggctgcccggcgccgcc
gccgccgagttccgcctcaaggagaagttcctgatgcggaaggtccgggtggtggaccgg
gaggaccgggacggcgagtggcgccacgccttcgaggtggcgccgaaggacggctgcggc
gtgctgttcgccgccaagtcagcagaggagaagaacggctggatggcggcgctggtgtcg
ctgcagtaccgcggcacgctggagcgcatgctggaccaggcgctgctgcaggacgaggag
cagcagatgcggctgccgtcggtccagcggtaccgcttcgccgaacccgactcggaccag
aacgttgtgtttgaggacagtgtccagtccaagtctggtatccccgtcattaaagccggg
acggtcctgaagctcatcgagaggctcaccttccacctgtacgcagatccaaactttgtc
cggacctttctgaccacgtaccggtccttctgccggcccggggagctgctggacctgctg
gtggagaggttcgacattcctgagccagcaccggccgaatcagacccgacagacgggttg
gagcagctactcagcgccgacctaaaacgattccgtaaagagtttgttcagccggtccag
ctcagggttctgaacgtgtgccgccactgggtggagcatcacttctacgacttcgagcga
gacccgggtctgctgagccgactggaggacttcatcgcttcggtcagagggaaggccatg
aggaaatgggtggagtccatcactaagatcatccagaggaaacagcaggtgcaggtgagc
caggcgagccccccccccagtatcactttccagaactcacccccccccatcgagtggcac
ctctgcaggcaaggagccgttgagacctttgacctcatgacccttcaccccatcgagatc
gcccgccagctgacgctgctcgagtctgacttctacagggcggtgcgtccgtcagagctg
gtgggaagtgtctggaccaaggaggacaaggagctacactcgcccaatctgctgaggatg
atccggcacaccaccaacctcaccctgtggctggagaagtgcattgttgagacggagaac
ctggaggagcgggttgccgtggtttctcggatcatcgagatcttgcaggttttccaggaa
ctgaataacttcaacggtgttctggaagtggtcagcgccatgaactcctcacctgtctat
agactggaccacactttcgagcaaatcccgagtcgccagaggaagatcctggaagaagct
catgagctgagtgaagatcactacaagaaatacctggccaagctgcgctccatcaacccg
ccctgcgtccctttctttgggatctatctgaccaatatactgaagacggaggagggaaac
ccggacttcctgcggcgacacggcaaagacctgatcaacttcagcaagaggcggaaagtg
gcagagatcactggagagatccaacagtaccagaaccagccttactgcttgagcgtggag
cccgacatcaggaagttcttggagaacctgaacccgatggaggacctgtctgagaaggac
tttgccgatcatctcttcaacaagtccttggagatcgaacctcgaaacacgcggtcgttg
cctcgttttgtgaagcggtacacctgtcctctgaagtccccagggatcagacccacgtcc
gcaagggtgggcagcatgagacatcctaccccactgcagaacgagcccaggaagatcagc
tacaaccgggtcaccgacagcgagtccgaaggcggcgtcatctctgctcccaactccccc
cgcacgccgctgactccgcccccagcctctgccgcgtccagctccacagatgtgggcagc
gtgttcgactcgcctcagggtccaagcagccccttccactcaacctgcgacagcatattc
gctgtaatctctctgcctcacggcccacggtcgtcctccgtctcttcaatggtgagcttc
agtcggacttcagaggatgctgccatcccccctccggttccgccgcgcagacgacccgaa
tcggctccttctgagtcctccccgaccaaggtccagtcagcgttggagagcccccccgct
gtgcctcctcgccagcccacctgtaagctcctcccccctcgttactcctcgctgtcctcg
tctcccccagacagcccccccttgctgcctccccgagagccgctcagctcccccctgcac
ctcctccctcccccacaggggcgctctcgctgcgaagtcttgtcccaggccttcttcccc
tcctcctcctcttcatctctgagctccgcccctgcgcccttgacttcctcaccaccactc
acccccacaggaaggaagatgcccttcccttccccgcctctagatggccccccggtgccg
ccgcgccacagcgtccccaaactgccccccaagacgtacaagagggagtctctgagcaac
gtgccccctgctggacacgccccctgctctgtggttggacatcttgtgaaagaggcggag
ctggaaacgctatag

DBGET integrated database retrieval system