KEGG   Xiphophorus couchianus (Monterrey platyfish): 114134863
Entry
114134863         CDS       T05908                                 

Definition
(RefSeq) cell wall integrity and stress response component 1-like
  KO
K08774  transforming growth factor, alpha
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04010  MAPK signaling pathway
xco04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:xco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    114134863
   04012 ErbB signaling pathway
    114134863
SSDB
Motif
Pfam: EGF Laminin_EGF hEGF
Other DBs
NCBI-GeneID: 114134863
NCBI-ProteinID: XP_027857514
LinkDB
Position
20
AA seq 245 aa
MTRILWDAIFLISGSFFTFGAGPSDSAVIEANVSIDAIATSAPDAPSNNSLTTSGKGKGT
ANFLTSRSSLFTEQTNSTVTDAAVSLNTSAAASRTPTSSSSTTISSTTSTTRRPAATTSK
RPVKKFVAAAVRSHFDDCPDSHQHFCFHGTCRFLILEETPACVCHPGFVGMRCEHADLLA
VVATNHRKQAVATVLVLCVIGCVLIMVLCSFLHCWWREDCRRRSRAHLYLAEKHGATCYP
PESVV
NT seq 738 nt   +upstreamnt  +downstreamnt
atgactcggattttgtgggatgctatttttctcataagcggttccttctttacatttgga
gcaggtccaagcgattcagctgtgattgaagcgaatgtttccatcgacgccatcgccacc
tctgctccagatgcacccagtaataattctttgaccaccagtggcaaaggaaaaggcaca
gctaactttcttacaagtagaagttctctttttacagagcaaacaaattcaacagtcaca
gatgctgcagttagtcttaatacctctgctgctgcttctcgcaccccaacaagcagctcc
tccacaaccatcagcagcacaacctcaacaaccagaagacctgctgcaacaaccagcaaa
cgtccagttaaaaagtttgtggctgcggcagttcggtctcatttcgatgactgtcctgac
tctcatcagcatttctgctttcatggcacctgccgcttcctgatcctggaggagacacct
gcatgtgtgtgtcatccaggctttgtcgggatgaggtgtgagcacgcagacctgctagct
gtagtagcaaccaaccacagaaagcaggctgtggccacagtgctcgtgctgtgcgtgatt
ggatgtgtcctcatcatggtgttgtgttcgttcttacactgctggtggagggaggactgt
cggaggcggagtcgagcgcatctctatctggcagaaaagcacggagcgacatgttatcca
ccagagagtgtggtttga

DBGET integrated database retrieval system