KEGG   Xiphophorus couchianus (Monterrey platyfish): 114135111Help
Entry
114135111         CDS       T05908                                 

Gene name
smarcc2
Definition
(RefSeq) SWI/SNF complex subunit SMARCC2 isoform X1
  KO
K11649  SWI/SNF related-matrix-associated actin-dependent regulator of chromatin subfamily C
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Brite
KEGG Orthology (KO) [BR:xco00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:xco03021]
    114135111 (smarcc2)
   03036 Chromosome and associated proteins [BR:xco03036]
    114135111 (smarcc2)
Transcription machinery [BR:xco03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     114135111 (smarcc2)
Chromosome and associated proteins [BR:xco03036]
 Eukaryotic type
  Chromatin remodeling factors
   BAF complex
    114135111 (smarcc2)
   PBAF complex
    114135111 (smarcc2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SWIRM-assoc_2 SWIRM SWIRM-assoc_1 SWIRM-assoc_3 Myb_DNA-binding Myb_DNA-bind_6 Chromo BRCT_2
Motif
Other DBs
NCBI-GeneID: 114135111
NCBI-ProteinID: XP_027857876
LinkDB All DBs
Position
20
AA seq 1054 aa AA seqDB search
MAVRKKDGGPNVKYFEASDTVSQFDNVRVWLGKNYKKYIQAEPPTNKSLSSLVVQLLQFQ
EEVFGRHVSNPPLTKLPMKCFLDFKSGGALCHILAAAYKFKSDQGWRRFDFQNPSRMDRN
VEMFMTIEKSLVQNNCLTRPVIYLSSDIEPKLLGKLKDIIKRHQGSVTEDKTSSSHIVVP
IPSSLEEEEWVRPVMKRDKQVLLHWGYFPDSYDTWIPASEIEAAVEDPPSPEKPRKVHAK
WILDLDQYNEWMNEEDYEVGEGCPKRKRISAKTLTDEVTTPDERRDKKPGSAKKRKRSPS
PSPTPPPQESKKKNTKKGPTTPYTKSKRGQREEEQEELSKDLDEASPVPASEEGTTAKTN
NTKKDSESTPVKGGTDVDEQEDESMETTGKEEEEGSPSVKGEPVKSSDLHEDNVTEQTHH
IIIPSYAAWFDYNSVHAIERRALPEFFNGKNKSKTPEIYLAYRNFMIDTYRLNPQEYLTS
TACRRNLAGDVCAIMRVHAFLEQWGLINYQVDSESRPTPMGPPPTSHFHVLADTPSSLVP
LQPKTSQTPATQPMISFPDKVKEKPTDLQNFGLRTDMYSKKTGSAKSKSAASSMREWTEQ
ETLLLLEGLEMYKDDWNKVSEHVGSRTQDECILHFLRLPIEDPYLEDSSSTLGPLAYQPV
PFSQAGNPVMSTVAFLASVVDPRVASAAAKSALEEFSRMKEEVPAALVEAHVRRVEEAAR
VSGRQDPLYGLEGSGIAGTGLEEGERPDESSDESKSDSQLSEEKRDAKESKDGAMEEEEK
QVENGKKEEERGREAEGEREADKTEPEMGDGEKEKDAKEGTEEGQREGEMEGERKAKVER
DVGEGNLATAAASALAAAAVKAKHLAAVEERKIKSLVALLVETQMKKLEIKLRHFEELET
IMDREREALEYQRQQLLADRQSFHMEQLKYAEMRARQQHFQQIQHQQHSQTGGPHSNQAA
SAAPPQGPSASQPAPSTPAPQAAPSPAPPASSAPPPESQPAAGTHTSSPCPPGQPPAPHS
SSSTTPVHHGELKEPSAPHQGESLHPSAPVPAPQ
NT seq 3165 nt NT seq  +upstreamnt  +downstreamnt
atggcggtgcggaagaaagacggcggcccgaatgtaaaatattttgaagcgtctgacacc
gtttcccagtttgataatgtccgcgtctggctgggaaagaattataaaaagtacatccag
gctgagccccccactaataaatctctgtccagcctggtggtccagctgctccagttccag
gaggaggttttcggcagacatgtcagcaatcctcccctcacaaagctgccgatgaaatgt
ttcctagacttcaagtcaggcggggctctgtgccacattctggctgctgcctacaagttc
aaaagtgaccaaggatggcgcaggtttgacttccagaatccgtcgaggatggaccgaaat
gtggagatgttcatgaccattgagaagtccttagtgcagaacaactgtctgactcgaccc
gtcatctacctgagctctgacatagaaccaaagctgctcggaaaactgaaagacatcatc
aaaagacaccagggctccgtgactgaggacaaaacctccagctcccatattgtggtgcct
attccttccagtctggaggaagaggagtgggtgcgtcctgtgatgaagagagacaagcag
gttctgctccactggggatatttcccagacagctatgacacctggatcccagccagtgag
attgaggctgcggtggaggatcctcccagcccagaaaagcccagaaaggttcatgcaaag
tggattttagaccttgaccagtataacgagtggatgaatgaggaagactatgaggtggga
gagggctgtccaaagaggaagaggatctctgccaagacgctgacagatgaggtgacaaca
ccagatgagagaagggacaagaaacccggcagtgccaagaaaagaaagcgatcgccatca
ccttcaccaacccctccgcctcaagagagcaagaaaaaaaatacaaaaaaagggccgacg
accccatacaccaagtctaaacgaggtcagagggaggaggagcaggaggagctgtccaag
gatctggatgaagcctcacctgttcctgcatctgaagagggaaccacagcaaagacaaat
aacaccaagaaggattctgaatcgaccccagttaagggaggcactgatgtggatgaacaa
gaagacgagtcaatggagacaacgggaaaggaagaggaggagggcagtcccagtgtgaag
ggtgaaccggtgaagagttcagaccttcatgaggacaacgtgacggagcaaactcaccac
atcatcatccccagctacgccgcctggttcgactacaacagtgttcatgccattgagcgg
cgagctctgcccgagtttttcaatgggaagaacaaatctaaaacccccgagatttatcta
gcatacaggaacttcatgattgacacctatcgactgaaccctcaggagtatttgacctcc
accgcctgccgcagaaacctggcaggagacgtgtgtgccatcatgagagttcatgctttt
ctagagcagtggggactgatcaactatcaggtggactcagagagtcggcccacgcccatg
ggacccccgccgacctctcacttccacgtcctggcggacactccttcaagtctggtcccc
ctgcagcccaaaacatcccagacccccgccacccagccgatgatatcattcccagacaag
gtgaaggagaagcccacagatctgcaaaactttgggcttcggaccgacatgtacagcaag
aagactgggtctgctaagagcaagagtgcagcgagctctatgagggagtggacagagcag
gaaacactactactacttgaggggctggagatgtataaggatgactggaacaaggtctct
gaacatgtgggcagccgtacacaagatgagtgcatcctgcacttcctgcggttaccaatc
gaagacccatacttggaggacagctcgtctactctgggccccctggcctaccagcccgtt
cccttcagccaagcaggaaaccccgtcatgagcaccgtggccttcctggcttctgtagtt
gacccacgtgtggcctcagctgcagccaaatccgctctcgaggagttttcccggatgaaa
gaggaggtccctgcagcgcttgttgaggctcacgtacggcgggtggaggaagcggcgaga
gtgagcggccgacaggatcccctgtatggtctggagggaagcggcatcgcaggcactggc
ctggaggagggagagaggcccgatgaaagcagcgatgaaagcaagagtgacagtcagttg
agtgaggagaaaagagatgctaaggagagtaaagatggagcgatggaagaggaagagaag
caggtggagaatgggaagaaagaagaagaaagaggaagagaagcagaaggcgagagagag
gcagataagacagagcctgagatgggtgacggtgagaaggagaaggatgctaaggaggga
acagaggagggacaaagagaaggagagatggaaggagagaggaaggctaaagttgagcgc
gatgtgggagagggaaacctggcaactgctgctgcctccgcgttagcagctgctgccgtc
aaagccaagcatttagctgcagtggaagagaggaagatcaaatctttggtggctctgctg
gtggagacccagatgaagaagcttgagattaaactgcgacactttgaagaactggaaact
atcatggacagagagcgggaggctctggagtaccagcggcagcagctgctggctgaccgc
cagtccttccacatggagcagctgaagtacgctgagatgagggcccgccagcagcacttc
cagcagatccagcaccagcagcacagccagaccggaggccctcactccaaccaggcggcc
tcggctgcaccgcctcaaggccccagtgccagtcagccagctcccagcacaccagctcct
caggcggcccccagtcctgccccaccagcttcttctgccccgccccccgagtcccaacct
gcagcaggcactcacacgtcatctccctgccctccaggccagcccccggcccctcactcc
agctccagcactacacccgtacaccacggtgagttaaaagagcccagcgctcctcaccaa
ggtgagtcactccacccatcagctcctgttcctgcaccacagtga

DBGET integrated database retrieval system