KEGG   Xiphophorus couchianus (Monterrey platyfish): 114135208
Entry
114135208         CDS       T05908                                 

Definition
(RefSeq) transforming protein RhoA
  KO
K04513  Ras homolog gene family, member A
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04144  Endocytosis
xco04150  mTOR signaling pathway
xco04270  Vascular smooth muscle contraction
xco04310  Wnt signaling pathway
xco04350  TGF-beta signaling pathway
xco04510  Focal adhesion
xco04520  Adherens junction
xco04530  Tight junction
xco04621  NOD-like receptor signaling pathway
xco04625  C-type lectin receptor signaling pathway
xco04810  Regulation of actin cytoskeleton
xco05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:xco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    114135208
   04350 TGF-beta signaling pathway
    114135208
   04150 mTOR signaling pathway
    114135208
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    114135208
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    114135208
   04520 Adherens junction
    114135208
   04530 Tight junction
    114135208
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    114135208
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    114135208
   04625 C-type lectin receptor signaling pathway
    114135208
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    114135208
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    114135208
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:xco04131]
    114135208
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:xco04147]
    114135208
   04031 GTP-binding proteins [BR:xco04031]
    114135208
Membrane trafficking [BR:xco04131]
 Endocytosis
  Lipid raft mediated endocytosis
   RhoA-dependent endocytosis
    114135208
Exosome [BR:xco04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   114135208
  Exosomal proteins of other body fluids (saliva and urine)
   114135208
  Exosomal proteins of colorectal cancer cells
   114135208
  Exosomal proteins of bladder cancer cells
   114135208
GTP-binding proteins [BR:xco04031]
 Small (monomeric) G-proteins
  Rho Family
   RhoA/B/C [OT]
    114135208
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU SRPRB Gtr1_RagA
Other DBs
NCBI-GeneID: 114135208
NCBI-ProteinID: XP_027858077
LinkDB
Position
20
AA seq 193 aa
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT
AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD
LRNDDHTRRELAKMKQEPVKPEDGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ
ARRGKKSNKCVLL
NT seq 582 nt   +upstreamnt  +downstreamnt
atggcagcaattaggaaaaagctggttatagtgggagatggagcctgtgggaagacctgc
ctgctcattgtattcagcaaggaccagtttcctgaagtctatgtgcccacagtgtttgag
aactacgtcgctgacattgaagttgacggaaaacaggttgaattagcgctctgggacaca
gcaggtcaagaggactatgaccgactccgtccactctcttatccagacactgatgtcata
ctcatgtgcttctccatcgacagcccagacagtcttgagaacatccctgagaagtggacc
cctgaggtgaaacacttctgccccaacgttcccatcatactggtgggaaataaaaaggat
ttgcgtaacgatgatcacactcggagggagctagctaaaatgaagcaggaacccgtgaaa
ccagaagatggccgggatatggccaacaggatcggtgccttcggatacatggagtgctct
gcaaaaacaaaggatggcgtgagggaagtgttcgagatggccaccagggctgcactacag
gccaggcggggaaagaagagcaataaatgcgtcctactgtaa

KEGG   Xiphophorus couchianus (Monterrey platyfish): 114142532
Entry
114142532         CDS       T05908                                 

Definition
(RefSeq) rho-related GTP-binding protein RhoA-C
  KO
K04513  Ras homolog gene family, member A
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04144  Endocytosis
xco04150  mTOR signaling pathway
xco04270  Vascular smooth muscle contraction
xco04310  Wnt signaling pathway
xco04350  TGF-beta signaling pathway
xco04510  Focal adhesion
xco04520  Adherens junction
xco04530  Tight junction
xco04621  NOD-like receptor signaling pathway
xco04625  C-type lectin receptor signaling pathway
xco04810  Regulation of actin cytoskeleton
xco05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:xco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    114142532
   04350 TGF-beta signaling pathway
    114142532
   04150 mTOR signaling pathway
    114142532
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    114142532
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    114142532
   04520 Adherens junction
    114142532
   04530 Tight junction
    114142532
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    114142532
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    114142532
   04625 C-type lectin receptor signaling pathway
    114142532
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    114142532
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    114142532
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:xco04131]
    114142532
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:xco04147]
    114142532
   04031 GTP-binding proteins [BR:xco04031]
    114142532
Membrane trafficking [BR:xco04131]
 Endocytosis
  Lipid raft mediated endocytosis
   RhoA-dependent endocytosis
    114142532
Exosome [BR:xco04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   114142532
  Exosomal proteins of other body fluids (saliva and urine)
   114142532
  Exosomal proteins of colorectal cancer cells
   114142532
  Exosomal proteins of bladder cancer cells
   114142532
GTP-binding proteins [BR:xco04031]
 Small (monomeric) G-proteins
  Rho Family
   RhoA/B/C [OT]
    114142532
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB
Other DBs
NCBI-GeneID: 114142532
NCBI-ProteinID: XP_027869668
LinkDB
Position
1
AA seq 193 aa
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT
AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD
LRNDDHTRRELAKMKQEPVKTEEGRDMSNRINASGYLECSAKTKDGVRDVFEMATRAALQ
AKKRGRKSGCALL
NT seq 582 nt   +upstreamnt  +downstreamnt
atggctgcgatcagaaagaaactggtgatagtgggtgatggagcctgtgggaagacatgt
ctgctcatagtgttcagcaaagatcagttccctgaggtctacgttcccaccgtgtttgag
aactatgtggcagacatcgaggtggatggtaaacaggtggagctggctctgtgggacact
gcgggtcaggaggattacgaccgtctcagacctctctcgtatccagacacagacgtcatt
ctcatgtgcttctccatcgacagccccgacagcttagagaatattcccgagaaatggact
ccggaggtgaagcatttctgtcccaatgtgcccataatcctggtgggaaataaaaaagac
ctgcgaaacgatgaccacactcgcagagagctggccaagatgaaacaggaaccggtgaag
acggaggagggcagggacatgtcaaaccggatcaatgcctctggttacctggagtgctca
gccaagacaaaagatggcgtgagggatgtttttgagatggccaccagagcggcgctgcag
gccaagaaaagaggcaggaagagtggctgcgctctgctatag

KEGG   Xiphophorus couchianus (Monterrey platyfish): 114144101
Entry
114144101         CDS       T05908                                 

Definition
(RefSeq) rho-related GTP-binding protein RhoA-B-like
  KO
K04513  Ras homolog gene family, member A
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04144  Endocytosis
xco04150  mTOR signaling pathway
xco04270  Vascular smooth muscle contraction
xco04310  Wnt signaling pathway
xco04350  TGF-beta signaling pathway
xco04510  Focal adhesion
xco04520  Adherens junction
xco04530  Tight junction
xco04621  NOD-like receptor signaling pathway
xco04625  C-type lectin receptor signaling pathway
xco04810  Regulation of actin cytoskeleton
xco05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:xco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    114144101
   04350 TGF-beta signaling pathway
    114144101
   04150 mTOR signaling pathway
    114144101
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    114144101
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    114144101
   04520 Adherens junction
    114144101
   04530 Tight junction
    114144101
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    114144101
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    114144101
   04625 C-type lectin receptor signaling pathway
    114144101
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    114144101
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    114144101
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:xco04131]
    114144101
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:xco04147]
    114144101
   04031 GTP-binding proteins [BR:xco04031]
    114144101
Membrane trafficking [BR:xco04131]
 Endocytosis
  Lipid raft mediated endocytosis
   RhoA-dependent endocytosis
    114144101
Exosome [BR:xco04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   114144101
  Exosomal proteins of other body fluids (saliva and urine)
   114144101
  Exosomal proteins of colorectal cancer cells
   114144101
  Exosomal proteins of bladder cancer cells
   114144101
GTP-binding proteins [BR:xco04031]
 Small (monomeric) G-proteins
  Rho Family
   RhoA/B/C [OT]
    114144101
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB
Other DBs
NCBI-GeneID: 114144101
NCBI-ProteinID: XP_027872393
LinkDB
Position
1
AA seq 193 aa
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT
AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD
LRNDEHTRRELAKMKQEPVKSEEGRDMAGRIAAFGYMECSAKTKDGVREVFEMATRAALQ
ARRGKKSNRCTLL
NT seq 582 nt   +upstreamnt  +downstreamnt
atggcagccatccgtaagaagctggtgatagtcggcgatggagcttgtgggaagacttgt
cttcttatcgtcttcagcaaggaccagttccctgaggtctacgttcccaccgtgtttgag
aactatgttgctgacatcgaagtggacggcaaacaggttgagctggctctctgggacacg
gccggtcaggaggactacgacaggctgagacccctctcctacccagacactgacgtcatc
ctcatgtgtttctccatagacagccctgacagcttggaaaacattcctgaaaaatggacc
ccggaggtcaaacacttctgccccaacgtccctataatccttgtaggaaacaagaaagat
ctacgtaatgatgaacacacgcgtcgagagctggccaagatgaagcaggaaccagtaaag
tcggaggaaggccgggacatggccgggcgcatcgcagcctttggttatatggagtgttct
gcgaagactaaggatggtgtacgggaggtgttcgagatggccaccagggcggcgctgcag
gcccgccgcggaaagaagagcaatagatgtacactgctgtaa

KEGG   Xiphophorus couchianus (Monterrey platyfish): 114153166
Entry
114153166         CDS       T05908                                 

Definition
(RefSeq) rho-related GTP-binding protein RhoA-D isoform X1
  KO
K04513  Ras homolog gene family, member A
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04144  Endocytosis
xco04150  mTOR signaling pathway
xco04270  Vascular smooth muscle contraction
xco04310  Wnt signaling pathway
xco04350  TGF-beta signaling pathway
xco04510  Focal adhesion
xco04520  Adherens junction
xco04530  Tight junction
xco04621  NOD-like receptor signaling pathway
xco04625  C-type lectin receptor signaling pathway
xco04810  Regulation of actin cytoskeleton
xco05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:xco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    114153166
   04350 TGF-beta signaling pathway
    114153166
   04150 mTOR signaling pathway
    114153166
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    114153166
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    114153166
   04520 Adherens junction
    114153166
   04530 Tight junction
    114153166
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    114153166
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    114153166
   04625 C-type lectin receptor signaling pathway
    114153166
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    114153166
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    114153166
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:xco04131]
    114153166
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:xco04147]
    114153166
   04031 GTP-binding proteins [BR:xco04031]
    114153166
Membrane trafficking [BR:xco04131]
 Endocytosis
  Lipid raft mediated endocytosis
   RhoA-dependent endocytosis
    114153166
Exosome [BR:xco04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   114153166
  Exosomal proteins of other body fluids (saliva and urine)
   114153166
  Exosomal proteins of colorectal cancer cells
   114153166
  Exosomal proteins of bladder cancer cells
   114153166
GTP-binding proteins [BR:xco04031]
 Small (monomeric) G-proteins
  Rho Family
   RhoA/B/C [OT]
    114153166
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB VASP_tetra
Other DBs
NCBI-GeneID: 114153166
NCBI-ProteinID: XP_027887371
LinkDB
Position
1
AA seq 209 aa
MIRLRRREARPKCQEIMAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIA
DIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVK
HFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKSEEGKDMAQRIGAFGYLECSAKTK
DGVREVFEMATRAALQVRKRKKRGGCQLL
NT seq 630 nt   +upstreamnt  +downstreamnt
atgattcggctacgtagaagagaagcgcgaccaaagtgtcaggaaataatggctgcgatc
agaaagaagctggtgatagttggagacggtgcgtgtgggaagacctgcctcctcatcgtc
ttcagcaaggatcagttcccagaagtctacgtccccactgtatttgagaactacatcgct
gacattgaagttgatggcaaacaggtggaattggcactgtgggatactgccggccaggag
gattatgaccgactgcggcctctctcctaccctgacaccgacgttatacttatgtgcttt
tccatagacagccctgacagtttagagaacattcctgagaaatggacccctgaagtaaag
cacttctgtcccaacgtccccatcatacttgtgggcaacaagaaggaccttagaaacgat
gaacacacacgcagagagttggccaagatgaaacaggagcctgtcaagtctgaggagggc
aaagacatggcacaacgcatcggtgcctttggctacctggagtgctcagccaagactaag
gacggtgtgcgggaagtgtttgagatggctaccagagcagcgctgcaggtccgcaagcgc
aagaagcggggcggctgccagttactgtga

KEGG   Xiphophorus couchianus (Monterrey platyfish): 114153549
Entry
114153549         CDS       T05908                                 

Definition
(RefSeq) transforming protein RhoA-like
  KO
K04513  Ras homolog gene family, member A
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04144  Endocytosis
xco04150  mTOR signaling pathway
xco04270  Vascular smooth muscle contraction
xco04310  Wnt signaling pathway
xco04350  TGF-beta signaling pathway
xco04510  Focal adhesion
xco04520  Adherens junction
xco04530  Tight junction
xco04621  NOD-like receptor signaling pathway
xco04625  C-type lectin receptor signaling pathway
xco04810  Regulation of actin cytoskeleton
xco05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:xco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    114153549
   04350 TGF-beta signaling pathway
    114153549
   04150 mTOR signaling pathway
    114153549
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    114153549
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    114153549
   04520 Adherens junction
    114153549
   04530 Tight junction
    114153549
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    114153549
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    114153549
   04625 C-type lectin receptor signaling pathway
    114153549
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    114153549
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    114153549
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:xco04131]
    114153549
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:xco04147]
    114153549
   04031 GTP-binding proteins [BR:xco04031]
    114153549
Membrane trafficking [BR:xco04131]
 Endocytosis
  Lipid raft mediated endocytosis
   RhoA-dependent endocytosis
    114153549
Exosome [BR:xco04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   114153549
  Exosomal proteins of other body fluids (saliva and urine)
   114153549
  Exosomal proteins of colorectal cancer cells
   114153549
  Exosomal proteins of bladder cancer cells
   114153549
GTP-binding proteins [BR:xco04031]
 Small (monomeric) G-proteins
  Rho Family
   RhoA/B/C [OT]
    114153549
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU SRPRB Gtr1_RagA
Other DBs
NCBI-GeneID: 114153549
NCBI-ProteinID: XP_027888011
LinkDB
Position
1
AA seq 193 aa
MGSIKKKLVIVGDGACGKTCLLTVFTKDLFPDVYVPTVFENYVADIEVDQKEIQLALWDT
AGQEDYDRLRPLSYPDTDVILLCFSVVSRDSLVNVKEKWTPEAKHFCPHVPIVLVGNKTD
LRDDESVRKMLAKQNEEPIKYEEGKDMSTQIAAYSYQECSAKNNDGVRQVFDTAAKAALT
YKRHQKKSHCALL
NT seq 582 nt   +upstreamnt  +downstreamnt
atgggctctatcaagaagaagttggtgatcgttggggacggtgcttgtgggaagacatgt
ctgctcacggttttcaccaaagacctcttccctgacgtctatgtgcctactgtatttgag
aactatgtggcagacattgaagtggatcagaaagagatacagttggcactttgggacaca
gcaggtcaggaagactatgaccgactgaggccgctttcctatccagacactgatgtaatc
cttctgtgcttctctgtggtcagccgggacagtttagtaaatgttaaagaaaagtggact
cctgaagcgaaacacttctgtcctcatgttcccatagtcctggtggggaacaaaacggat
cttcgcgacgatgagagtgtcagaaaaatgcttgccaaacagaacgaggagccaattaaa
tatgaagagggcaaagacatgtctacacaaattgccgcctacagctaccaggagtgttct
gctaaaaacaatgatggcgtgaggcaagtctttgacactgcagctaaggcagcgttgacg
tacaagagacatcagaagaagagtcactgtgcgcttttataa

DBGET integrated database retrieval system