KEGG   Xiphophorus couchianus (Monterrey platyfish): 114135246
Entry
114135246         CDS       T05908                                 

Definition
(RefSeq) cell division control protein 42 homolog
  KO
K04393  cell division control protein 42
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04010  MAPK signaling pathway
xco04144  Endocytosis
xco04370  VEGF signaling pathway
xco04510  Focal adhesion
xco04520  Adherens junction
xco04530  Tight junction
xco04810  Regulation of actin cytoskeleton
xco04912  GnRH signaling pathway
xco05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:xco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    114135246
   04370 VEGF signaling pathway
    114135246
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    114135246
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    114135246
   04520 Adherens junction
    114135246
   04530 Tight junction
    114135246
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    114135246
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    114135246
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    114135246
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:xco04131]
    114135246
   03036 Chromosome and associated proteins [BR:xco03036]
    114135246
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:xco04147]
    114135246
   04031 GTP-binding proteins [BR:xco04031]
    114135246
Membrane trafficking [BR:xco04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    114135246
 Endocytosis
  Lipid raft mediated endocytosis
   GRAF1-dependent endocytosis
    114135246
  Macropinocytosis
   Ras GTPases
    114135246
Chromosome and associated proteins [BR:xco03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    114135246
Exosome [BR:xco04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   114135246
  Exosomal proteins of breast milk
   114135246
GTP-binding proteins [BR:xco04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    114135246
SSDB
Motif
Pfam: Ras Roc Arf PET117 GTP_EFTU
Other DBs
NCBI-GeneID: 114135246
NCBI-ProteinID: XP_027858149
LinkDB
Position
20
AA seq 191 aa
MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG
QEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLR
DDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPP
EPKKKRKCVLL
NT seq 576 nt   +upstreamnt  +downstreamnt
atgcagaccatcaagtgtgttgtagtcggtgacggtgctgtgggtaaaacctgcctgctc
atctcttacactacaaacaagtttccgtccgaatatgtacctacggtgtttgacaactat
gctgtaactgtaatgatcggtggggaaccctatactttgggattgtttgacacagcaggt
caagaagactacgacaggttacgtcctttgagttatccgcagacagatgtcttcctcgtc
tgtttttcagttgtgtccccttcctcctttgaaaatgtcaaagaaaagtgggttcctgaa
attacccaccactgtccaaagacgcccttccttctagtcgggacgcagatcgacttgagg
gacgacccgtcaactatagagaagctggccaagaacaagcagaagcccatcaccccagag
acggcagagaagctggcaagagacctcaaggcagttaaatatgtggagtgctcagccctc
acacagaaaggcctaaagaatgtgtttgatgaggcgatattggctgcactggagccccca
gagcctaagaagaaacgcaaatgtgtgctcttatga

KEGG   Xiphophorus couchianus (Monterrey platyfish): 114142284
Entry
114142284         CDS       T05908                                 

Definition
(RefSeq) cell division control protein 42 homolog
  KO
K04393  cell division control protein 42
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04010  MAPK signaling pathway
xco04144  Endocytosis
xco04370  VEGF signaling pathway
xco04510  Focal adhesion
xco04520  Adherens junction
xco04530  Tight junction
xco04810  Regulation of actin cytoskeleton
xco04912  GnRH signaling pathway
xco05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:xco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    114142284
   04370 VEGF signaling pathway
    114142284
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    114142284
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    114142284
   04520 Adherens junction
    114142284
   04530 Tight junction
    114142284
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    114142284
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    114142284
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    114142284
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:xco04131]
    114142284
   03036 Chromosome and associated proteins [BR:xco03036]
    114142284
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:xco04147]
    114142284
   04031 GTP-binding proteins [BR:xco04031]
    114142284
Membrane trafficking [BR:xco04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    114142284
 Endocytosis
  Lipid raft mediated endocytosis
   GRAF1-dependent endocytosis
    114142284
  Macropinocytosis
   Ras GTPases
    114142284
Chromosome and associated proteins [BR:xco03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    114142284
Exosome [BR:xco04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   114142284
  Exosomal proteins of breast milk
   114142284
GTP-binding proteins [BR:xco04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    114142284
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU
Other DBs
NCBI-GeneID: 114142284
NCBI-ProteinID: XP_027869287
LinkDB
Position
3
AA seq 191 aa
MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG
QEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEISHHCPSTPFLLVGTQVDLR
EDSNTVEKLAKNKQRPLFPESGEKLARELKAVKYVECSALTQRGLKNVFDEAILAALEPP
EIKTKRKCVLL
NT seq 576 nt   +upstreamnt  +downstreamnt
atgcagactataaaatgtgtagttgtaggggacggtgcagttggaaaaacctgcttgttg
atctcctacacaaccaacaagttcccctcagaatatgtgcccacagtttttgacaattat
gctgtgacggtgatgattgggggggagccctacacgctgggcctcttcgataccgcaggt
caggaggattacgacaggctgcgtcctctcagctacccacaaacagatgttttcctcgta
tgtttctcggttgtctccccgtcgtcgtttgaaaacgtcaaagaaaagtgggttccggag
atttctcaccactgtccaagcacacctttcctgttggtgggaacgcaagtagacctgcgg
gaagacagcaacaccgtggagaagctggctaaaaacaaacagcgccccctgttccctgag
agcggggagaagctggctcgggagctcaaagctgtcaaatacgtggagtgctctgcgctc
acgcagcgagggctgaagaacgtgtttgacgaggccatactggcggcgctagaacctccg
gagatcaaaacgaagaggaaatgtgttctcctataa

KEGG   Xiphophorus couchianus (Monterrey platyfish): 114144619
Entry
114144619         CDS       T05908                                 

Definition
(RefSeq) cell division control protein 42 homolog isoform X1
  KO
K04393  cell division control protein 42
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04010  MAPK signaling pathway
xco04144  Endocytosis
xco04370  VEGF signaling pathway
xco04510  Focal adhesion
xco04520  Adherens junction
xco04530  Tight junction
xco04810  Regulation of actin cytoskeleton
xco04912  GnRH signaling pathway
xco05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:xco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    114144619
   04370 VEGF signaling pathway
    114144619
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    114144619
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    114144619
   04520 Adherens junction
    114144619
   04530 Tight junction
    114144619
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    114144619
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    114144619
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    114144619
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:xco04131]
    114144619
   03036 Chromosome and associated proteins [BR:xco03036]
    114144619
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:xco04147]
    114144619
   04031 GTP-binding proteins [BR:xco04031]
    114144619
Membrane trafficking [BR:xco04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    114144619
 Endocytosis
  Lipid raft mediated endocytosis
   GRAF1-dependent endocytosis
    114144619
  Macropinocytosis
   Ras GTPases
    114144619
Chromosome and associated proteins [BR:xco03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    114144619
Exosome [BR:xco04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   114144619
  Exosomal proteins of breast milk
   114144619
GTP-binding proteins [BR:xco04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    114144619
SSDB
Motif
Pfam: Ras Roc Arf PET117 GTP_EFTU
Other DBs
NCBI-GeneID: 114144619
NCBI-ProteinID: XP_027873502
LinkDB
Position
1
AA seq 191 aa
MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG
QEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLR
DDPSTVEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPP
EPKKRPKCVLL
NT seq 576 nt   +upstreamnt  +downstreamnt
atgcagactatcaaatgtgttgtggttggagatggagcagtgggaaaaacctgcttactg
atttcatacaccaccaacaagttcccttctgaatatgtaccaacagtgtttgataactat
gcagtaactgtaatgatcgggggtgaaccatacacccttggcttatttgatacagcaggt
caggaggattacgacaggttacgaccactaagctaccctcagaccgatgtcttcctagtc
tgtttctctgttgtttcaccttcctcatttgagaatgttaaagaaaagtgggttcctgaa
atcacccaccattgtcccaagaccccgttcctgttggtaggcactcagattgacctccgt
gatgacccctccacagtggagaagttggccaagaacaaacagaagccaatcacccctgag
acagcagaaaagctggctcgagaccttaaggcagtcaaatacgtggagtgctcagccctg
actcagaaaggattaaagaatgtgtttgatgaggcaatactagccgccctggagcctccc
gaacctaagaaaaggcctaaatgtgttctgctctaa

KEGG   Xiphophorus couchianus (Monterrey platyfish): 114156104
Entry
114156104         CDS       T05908                                 

Definition
(RefSeq) cell division control protein 42 homolog
  KO
K04393  cell division control protein 42
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04010  MAPK signaling pathway
xco04144  Endocytosis
xco04370  VEGF signaling pathway
xco04510  Focal adhesion
xco04520  Adherens junction
xco04530  Tight junction
xco04810  Regulation of actin cytoskeleton
xco04912  GnRH signaling pathway
xco05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:xco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    114156104
   04370 VEGF signaling pathway
    114156104
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    114156104
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    114156104
   04520 Adherens junction
    114156104
   04530 Tight junction
    114156104
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    114156104
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    114156104
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    114156104
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:xco04131]
    114156104
   03036 Chromosome and associated proteins [BR:xco03036]
    114156104
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:xco04147]
    114156104
   04031 GTP-binding proteins [BR:xco04031]
    114156104
Membrane trafficking [BR:xco04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    114156104
 Endocytosis
  Lipid raft mediated endocytosis
   GRAF1-dependent endocytosis
    114156104
  Macropinocytosis
   Ras GTPases
    114156104
Chromosome and associated proteins [BR:xco03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    114156104
Exosome [BR:xco04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   114156104
  Exosomal proteins of breast milk
   114156104
GTP-binding proteins [BR:xco04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    114156104
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU PET117
Other DBs
NCBI-GeneID: 114156104
NCBI-ProteinID: XP_027892128
LinkDB
Position
13
AA seq 191 aa
MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG
QEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVREKWVPEISHHCPRTPFLLVGTQVDLR
DDSNTMEKLAKNKQRPMSCESGEKLARELRAVKYVECSALTQRGLKNVFDEAILAALEPP
DIKPKKRCLLL
NT seq 576 nt   +upstreamnt  +downstreamnt
atgcagactataaaatgtgtggtagtgggtgatggtgctgtggggaaaacttgcctgctc
atctcctacacaaccaacaagtttccctctgaatacgtaccaaccgtctttgataactat
gctgtgacagtgatgattggaggggagccatacacccttggactgtttgacactgcaggt
caggaggactatgacagactgcgaccccttagctaccctcaaaccgacgttttcctcgtc
tgtttctcagtcgtatcgccttcctcctttgaaaacgtcagagagaagtgggtccctgag
atttctcaccactgcccgcggacgcccttcttgctggttggaactcaggtggatttaaga
gacgacagcaacacaatggagaagctggccaagaacaaacaacgacccatgagctgtgaa
agtggggagaaactggcgcgagagctcagagctgtcaaatatgtggagtgctcagctctg
acgcagagaggattgaagaacgtgtttgatgaggccatcctggcagccctggagccccca
gacatcaaacccaaaaagcgctgccttctcctatag

DBGET integrated database retrieval system