KEGG   Xiphophorus couchianus (Monterrey platyfish): 114135298
Entry
114135298         CDS       T05908                                 

Definition
(RefSeq) proto-oncogene tyrosine-protein kinase Src isoform X1
  KO
K05704  tyrosine-protein kinase Src [EC:2.7.10.2]
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04012  ErbB signaling pathway
xco04137  Mitophagy - animal
xco04144  Endocytosis
xco04370  VEGF signaling pathway
xco04510  Focal adhesion
xco04520  Adherens junction
xco04530  Tight junction
xco04540  Gap junction
xco04625  C-type lectin receptor signaling pathway
xco04810  Regulation of actin cytoskeleton
xco04912  GnRH signaling pathway
xco05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:xco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    114135298
   04370 VEGF signaling pathway
    114135298
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    114135298
   04137 Mitophagy - animal
    114135298
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    114135298
   04520 Adherens junction
    114135298
   04530 Tight junction
    114135298
   04540 Gap junction
    114135298
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    114135298
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    114135298
  09152 Endocrine system
   04912 GnRH signaling pathway
    114135298
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    114135298
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:xco01001]
    114135298
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:xco04131]
    114135298
Enzymes [BR:xco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     114135298
Protein kinases [BR:xco01001]
 Non-receptor tyrosine kinases
  SRC family
   114135298
Membrane trafficking [BR:xco04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    114135298
 Endocytosis
  Clathrin-mediated endocytosis
   Kinases
    114135298
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    114135298
  Macropinocytosis
   Kinases
    114135298
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase SH2 SH3_1 SH3_9 SH3_2 APH zf-RING_14
Other DBs
NCBI-GeneID: 114135298
NCBI-ProteinID: XP_027858243
LinkDB
Position
20
AA seq 550 aa
MGAGKSKPKEPGQRSMSLDGTIGTGSDSGHFHHLGPSQQTQTPNRSPAVGTGRPRYQGQH
QHAPTNTPELSLFGGVDHTGTVTSPQRGPLSGGVTTFVALYDYESRTVSDLTFRKGDRLQ
IVNNTKKYSFREGDWWFARSLTTGESGYIPSNYVAPSDSIQAEEWYFGKITRRDSERLLL
NPQNRRGTFLVRESETTKGAYCLSVLDYDNTKGLNVKHYKIRKLDSGGFYITTRTQFTSL
QQLVFHYRKHSDGLCHALTDVCPVAKPQTQGLARDAWEIPRESLRLDVKLGQGCFGEVWM
GTWNGTTRVAIKTLKPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMSQ
GSLLDFLKGDAGKMLRLPQLVDMAAQIAAGMAYVERMNYVHRDLRAANILVGDNLVCKVA
DFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGVLLTELATKGRVPY
PGMVNREVLDQVERGYRMPCPAECPTSLHDLMLSCWRKDPEERPTFEYLQGFLEDYFTST
EPQYQPGENL
NT seq 1653 nt   +upstreamnt  +downstreamnt
atgggggcaggcaagagtaagcccaaggagccgggccagcgttccatgagcctggatggt
accataggcacaggctcagacagcggacacttccaccacctgggcccctctcagcagaca
cagacccccaaccgaagccctgctgtcggcacaggcaggccgaggtaccaggggcagcac
caacacgccccaacaaacaccccagaactgagtctcttcggaggggtggaccacacagga
acagtaacatcacctcagagaggacctctgtcaggaggcgtcactacatttgtggcgctg
tacgactacgagtcgcggacagtgagcgacctgaccttcaggaaaggcgaccggctgcag
attgtgaacaacacgaaaaagtacagcttcagagaaggggactggtggttcgctcgctcg
ctcacaacaggagaaagcggttacatccccagcaactacgtggctccgtccgactccatc
caagctgaagagtggtatttcgggaagatcactcgacgtgactcggagaggctccttttg
aacccgcagaaccgacgaggaaccttcctagtgagagagagcgagaccacgaaaggggcg
tactgcctgtcagtgctggattatgacaacaccaaaggcctcaatgtaaaacattacaag
atcaggaagctggatagcggaggtttctacatcaccactcgcacccagttcaccagctta
cagcaactagtcttccactaccgcaagcactcagatgggttgtgtcatgctctgacggat
gtatgtccagtggccaaacctcagacacaaggcttggccagggatgcctgggagattcct
cgagagtccctccgattggatgttaaactcggacagggctgctttggagaagtctggatg
ggaacatggaatggtacaacgcgggtagccattaagaccttaaagccgggcacgatgtct
ccagaggcctttctacaggaagcacaggtcatgaaaaagctaaggcacgagaagctggtc
cagctgtatgccgtagtgtctgaggagcccatctacattgtgacagagtatatgagtcaa
ggtagcttattggacttcctcaaaggggatgcaggaaagatgcttcgtctgccacagctg
gtagacatggctgctcagattgctgccgggatggcttatgtggagaggatgaactacgtt
cacagagacctgcgtgcagcaaacatcttggtgggagacaacctggtgtgtaaggtggcc
gactttggtctcgcaagactgattgaagacaacgagtacacagcaaggcaaggtgccaag
tttccaatcaaatggactgcacccgaggcagcgctgtacggccgtttcaccataaagtca
gacgtctggtcctttggggtgcttctcacagagctcgcaaccaaaggccgagttccctat
ccaggtatggttaatcgagaggtgcttgaccaggttgagcgtggctacaggatgccttgc
ccagcagagtgccccacttccttgcatgacctcatgctttcctgctggagaaaggatcct
gaagagaggcctacatttgagtacctgcagggcttcctagaagactacttcacctccaca
gaaccccagtatcaacctggggagaacctatag

KEGG   Xiphophorus couchianus (Monterrey platyfish): 114140865
Entry
114140865         CDS       T05908                                 

Definition
(RefSeq) proto-oncogene tyrosine-protein kinase Src-like isoform X1
  KO
K05704  tyrosine-protein kinase Src [EC:2.7.10.2]
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04012  ErbB signaling pathway
xco04137  Mitophagy - animal
xco04144  Endocytosis
xco04370  VEGF signaling pathway
xco04510  Focal adhesion
xco04520  Adherens junction
xco04530  Tight junction
xco04540  Gap junction
xco04625  C-type lectin receptor signaling pathway
xco04810  Regulation of actin cytoskeleton
xco04912  GnRH signaling pathway
xco05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:xco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    114140865
   04370 VEGF signaling pathway
    114140865
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    114140865
   04137 Mitophagy - animal
    114140865
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    114140865
   04520 Adherens junction
    114140865
   04530 Tight junction
    114140865
   04540 Gap junction
    114140865
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    114140865
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    114140865
  09152 Endocrine system
   04912 GnRH signaling pathway
    114140865
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    114140865
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:xco01001]
    114140865
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:xco04131]
    114140865
Enzymes [BR:xco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     114140865
Protein kinases [BR:xco01001]
 Non-receptor tyrosine kinases
  SRC family
   114140865
Membrane trafficking [BR:xco04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    114140865
 Endocytosis
  Clathrin-mediated endocytosis
   Kinases
    114140865
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    114140865
  Macropinocytosis
   Kinases
    114140865
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase SH2 SH3_1 SH3_9 SH3_2 APH
Other DBs
NCBI-GeneID: 114140865
NCBI-ProteinID: XP_027866933
LinkDB
Position
24
AA seq 542 aa
MGGSKSKPKDVAQRNRSLDSNISSGGGAGSLHHNSAQQSATPNRSTIVDTDPQLMSNNAG
LVLFGGVDNNRITPTGVTAFVALYDYESRTETDLSFKKGERLQILNNTRKINCREGDWWL
ANSLTTGKSGYIPSNYVAPSDSIQAEDDLKLTLDSRWFFAKITRRDSERMLLALENRRGT
FVVRESETTKGAYCLSVLDCDNTRGLNVKHYKIRKLDSGGFYITSRTPFATLQQLVNHYR
KHADGLCHTLTDVCPVLKPQTQGLSKDAWEIPRESLRLEVKMGQGCFGEVWRGTWNGTTQ
VAIKTLKPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEFMDQGSLLEFLK
GQYSTMLRLPQLVDFASQIASGMAYVERMNYVHRDLRAANILVGDNLVCKVADFGLARLI
EDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLVELATKGRVPYPGMVNREV
LDQVERGYRMPCPSECPASLHELMLNCWRKEAEERPTFEYLQGFLEDYFTSTEPQYQPGD
NL
NT seq 1629 nt   +upstreamnt  +downstreamnt
atggggggatccaagagtaagcccaaagacgttgcccagcgaaaccgcagcctcgacagt
aacatcagctcagggggaggggctggcagtctccaccacaattcggctcaacagtcagcg
acacccaaccgcagcacaattgtggacacagatccacaattaatgagcaataatgccgga
ctcgttctgtttggaggtgtggacaataacagaataactccaacaggtgtgacggcattt
gtggccttgtacgactacgagtctcgaacagagacagatctgtctttcaagaagggggag
cgtctccagatactaaataacacgaggaagataaactgcagggaaggggactggtggctg
gcgaactccctgaccaccggaaagagcggttatatccccagcaattatgtggctccatct
gactccatccaggcagaagatgatctcaaactgacactagattccagatggttctttgcc
aaaatcacacgccgtgattcagaaaggatgctgctagctttagaaaacagaagagggact
ttcgtggtgagagagagtgagaccaccaaaggtgcttactgtctgtcagtgttggactgt
gacaacaccagagggctcaacgtgaaacactacaagattaggaagctggacagcgggggc
ttctacatcacatcccgcacacctttcgccacactgcagcagctcgtcaatcattaccgc
aagcatgccgatgggctgtgtcacactctgacggacgtttgtcccgtactgaagcctcag
actcagggcttatccaaggacgcctgggagatcccgagagagtcgcttcgcctggaggtc
aagatgggacagggctgcttcggagaggtctggagaggaacatggaacggcaccacacag
gtggcgatcaagacgctgaagcccggcaccatgtcccccgaggcgttcctgcaggaagct
caggtcatgaagaaactgagacacgagaagctggttcagctgtacgctgtggtttctgag
gagcccatctacatcgtaacagagttcatggaccaaggcagcttattggagtttctgaag
ggacagtatagtacgatgctccgcctccctcagctggtggactttgcctctcagattgct
tcagggatggcctacgtagagaggatgaactacgttcatagagatctccgagccgctaac
atcctggttggagataatctggtttgcaaagtggctgattttggtttggctcgcctgatt
gaggataacgaatatacagccaggcaaggcgccaagtttcccatcaagtggacggctcct
gaggcggcgctctacggacgattcaccattaaatctgacgtctggtcatttgggatcctg
ctggttgaactggccaccaaaggtcgcgtgccctacccaggcatggtgaacagagaggtt
ctggatcaggtggagcgcggatacaggatgccgtgtccgtctgaatgtcctgcttctctc
catgaactgatgctgaactgctggaggaaggaggccgaggagaggcccaccttcgagtac
ctgcagggcttcctggaggattacttcacctccactgagcctcagtaccagcctggggat
aacctgtaa

DBGET integrated database retrieval system