KEGG   Xiphophorus couchianus (Monterrey platyfish): 114135350
Entry
114135350         CDS       T05908                                 

Definition
(RefSeq) ras association domain-containing protein 1-like isoform X1
  KO
K09850  Ras association domain-containing protein 1
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
SSDB
Motif
Pfam: Nore1-SARAH RA C1_1
Other DBs
NCBI-GeneID: 114135350
NCBI-ProteinID: XP_027858379
LinkDB
Position
20
AA seq 367 aa
MESFCIKDRMTNCELIELKDLSVNDSIELAAPSSHIACAPVNPSQPGAGRVVRLVGDSVS
IEGPVRHLGERAVGHDFQPYSYTHLSWCDLCGEFIWGLYKQSLRCANCSYTCHYRCRPFI
QLDCSTQGSVLTENTDYSEDSIETDTNVDDQTEPGKQELSVGKIQQKVKEYNAQINNNLY
MVDNKDGTYTGFIKVHFQLLRPISLPPSRNQSWTEEDDQQERLTRRRTSFYLPKDAAKHL
HVSSETRVREVIEALLNKFTVVDNPAKFALFERAEKQSQVFMRKLSDDERPLYLRLCAGP
SESVLSLVLKENETGDVNWDAFSFPELNNFLRILQREEEEHVRQIVNRYAHARDMIRHAM
ARVTTPG
NT seq 1104 nt   +upstreamnt  +downstreamnt
atggaaagtttctgcatcaaagacaggatgactaactgtgagctgattgagctgaaggac
ctcagtgtgaacgattccatcgagctagccgctccatcctcacacatcgcctgtgcccct
gtcaatccgagccagcctggcgctggccgcgttgtccgtctggttggagacagcgtcagc
atcgagggaccggtccgtcacttgggagagagggcagtgggccatgacttccagccctat
agctacacacacctcagctggtgtgacctgtgtggagaattcatctggggtctctataag
cagagcttacgctgtgccaactgcagctacacttgtcactaccgctgccgaccgtttatc
cagctggactgcagcacacaggggagtgtgttaacggagaacacagactacagtgaggac
tccatcgagacggacacaaacgtggatgaccagactgaaccgggtaaacaagagttaagt
gttggtaagattcagcagaaggtgaaggagtacaacgctcagatcaacaacaatctctac
atggtggataataaagatgggacgtacactggtttcataaaggtccactttcagttactc
cgccccatctccctcccaccttctcggaaccagagctggacagaggaggacgatcagcaa
gaaagactgacaaggcggcggacgtctttctacctccccaaagatgcagcaaagcacctc
catgtgagctcagaaacccgagtgcgagaagtcatcgaggcgttgctgaacaagttcact
gtggtcgacaatccggcaaagtttgccttgtttgaacgtgctgaaaagcaaagtcaagtg
ttcatgcgtaagctgtctgatgacgagcgccctttgtatttgcgcttatgtgctggaccc
agtgaatcagtcttgagtctggttttgaaggagaatgaaacaggggatgtaaattgggat
gccttcagctttcctgagctgaacaacttcttgcgaatcttacagcgcgaggaagaagag
catgtgcggcagattgtgaatcgctatgctcatgctagagacatgataaggcacgcaatg
gcccgcgtaactacccctggttga

DBGET integrated database retrieval system