KEGG   Xiphophorus couchianus (Monterrey platyfish): 114135648
Entry
114135648         CDS       T05908                                 

Gene name
rassf1
Definition
(RefSeq) ras association domain-containing protein 1 isoform X1
  KO
K09850  Ras association domain-containing protein 1
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
SSDB
Motif
Pfam: RA Nore1-SARAH C1_1 Ras_bdg_2 DUF5113 Cut8 DUF5111
Other DBs
NCBI-GeneID: 114135648
NCBI-ProteinID: XP_027858905
LinkDB
Position
20
AA seq 365 aa
MSWGEFIELRDLNSGREQIGLAGPRLPCSPPRLERTNALRISPGKVPDLLSRVGIIRVLS
SSQDPQFVEEKGEGHNFQPCSHAQPTWCDLCGDFIWGLYKQSLRCVNCRFTCHYRCRALI
RLDCSWERGSTADLTAVVEHTIETDTNVDEQIQCEKQELSTAEILQKVKEYNSQINSNLF
MNMNKDGSYTGFVKVQFKLVRPVSVPAPKKGGADAGGKRASGVKRRTSFYLPKDASKHLH
ISSRTSAREVIEALLKKFTVVDNPGKFALFERSERHDQVYVRKLSDDERPLRLRLNAGPN
EKLLSFVLKENETGEVNWHAFSMPELKNFLLILQREEEEHVKQIVQRYTLARTKMLEALS
GSTPG
NT seq 1098 nt   +upstreamnt  +downstreamnt
atgtcttggggcgagttcatcgagctccgggacctgaactccggcagagagcagatagga
ctggcaggcccgcgtttgccctgctctcccccacgcctggagcgaacgaacgccttgagg
atcagcccggggaaggtgccggacctgctgagccgggtgggcatcatccgggtcctgagc
agctcccaggatccccaatttgtggaggagaaaggagagggacacaactttcagccctgc
agccacgctcagccaacatggtgcgacctgtgcggcgacttcatctggggcctttacaag
cagagcctgcggtgtgtcaattgcagattcacgtgccactaccgctgccgtgcgctgatt
cggctggactgcagctgggagcgaggctctacggcggacctcaccgctgtcgtggagcac
acaatcgaaacagacacgaatgtggatgaacaaatccaatgtgagaaacaggagctatca
actgctgaaattctgcagaaagtgaaggaatacaactcccagatcaatagcaatctgttc
atgaacatgaacaaggacgggtcctacactggttttgtgaaggttcaattcaagctagtg
cgccccgtgtcggtcccagcgccaaagaaaggaggtgctgatgctggagggaagcgagcc
agcggggtgaagcgtcgcacctccttctacctgccaaaggacgcctccaagcatttgcac
ataagctcccgtacttctgctcgcgaggtcatcgaggctctgctgaaaaagtttactgtg
gtagacaatcccggcaagtttgcactgtttgagcgcagcgagcgccatgaccaagtttat
gttcgcaagctctctgacgacgagcgtcctctccgtttgcgcctgaatgctggacccaac
gagaagctcctcagttttgttctcaaagaaaatgaaactggagaagtgaattggcatgct
ttctccatgccagagctgaagaacttcctgctgatcctgcagcgtgaggaagaggagcac
gtcaagcagatcgtacagcgatacactttggctcgcaccaagatgctggaggcactgtcc
ggctcgacgccgggctga

DBGET integrated database retrieval system