KEGG   Xiphophorus couchianus (Monterrey platyfish): 114135667
Entry
114135667         CDS       T05908                                 

Gene name
gli1
Definition
(RefSeq) zinc finger protein GLI1 isoform X1
  KO
K16797  zinc finger protein GLI1
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:xco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    114135667 (gli1)
Transcription factors [BR:xco03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 GLI-like
    114135667 (gli1)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 FOXP-CC
Other DBs
NCBI-GeneID: 114135667
NCBI-ProteinID: XP_027858956
LinkDB
Position
20
AA seq 1486 aa
MPVDMQPHQGLYYYETSPSQPSRGIVPSDQSPYSDVSPLRVLHLDGPPQDCHTMYNPMTP
SMAHGSGSGPVQGNSHCLDQYMRPPQALPLHNMMGHRGMPPTEGSNSAPYCNQNNMMSSH
PNFCQLQPSSEQIGSGDGSRFSTPRSMLKLSKKRALSISPLSDASVDLQTVIRTSPNSLV
AFVNSRCNPNGASSYGHLSVSAMSPSLNYSSNINCHSRQQGSIYGGNGGTPLGVHTPGPC
QASRLPPHNPRLLVPPKHGHQLKTEPGLVGVMDGMNVKNLEERSEGDVASPSSTGTQQDH
LMGLLDGRDDLDKEDGKPEPEAIYETNCRWESCNKEFDTQDQLVHHINNEHIHGEKKEFV
CHWQECSREQRPFKAQYMLVVHMRRHTGEKPHKCTFEGCNKAYSRLENLKTHLRSHTGEK
PYVCEHEGCNKAFSNASDRAKHQNRTHSNEKPYVCKIPGCTKRYTDPSSLRKHVKTVHGP
EAHITKKHRGDTGPRPPGSALTSGGQTSELLLEKEETCREDCKLLAPETALKSQPSPGAQ
SSCSSERSPLGSTNNNDSGVEMNLNAAGSLDDLTALEDGVAGGGSGGGGEPGTMGMSAQA
LKRLENLKIDKLKQIRRPTPPGRCASNKLPAISGSGDNMGMCAPSPLNRRVMELSNHELG
AGNIANSTNDRRGSGTSSLSSAYTVSRRSSMASPYLSSRRSSDVSQIGGTAGGGCHLLSP
EQAGGDPLSPETYRRGAPCPGGGGLPGLPNLTPAQHYSLKAKYAAATGGPPPTPLPNMEQ
SGTPVRRGGPLSEYQGQPLPPFLQQGGPRRHSANTEYGTGVIYPHQAPGNNTRRASDPVR
SVADPQALPKRFNSLNNVAMMGRRNALQLRSSDTGLSRHMYSPRPPSITENVMMEAMGME
PHLNTVDPRDRSMMMTPVERNFMSFQQQNQTMGGGGPLPNQLSPSHDSLGCPDPAYIQRH
YQGHGGEVISRASGNPLSQARPTQPDGMSNTLLQQAEYGMSTCQLSPSGPHYPGIGQGSD
SGGPWNDNHNQIQTSSHAIQNQQSVRFSDSSLQPQQTQAHFNNQTALYNNSDGTHKPFIK
PEQQFHPGMGGGDACQSAKLQQQRILLQQTQTYPQQSVQVLMRNSGHPSCDFQGQNPGSY
PSGGGLSLGCAGSALSEGQRSETPMMQVKEMMVRNYVQSQQALMWEQQQEQEQQSGIKPT
SLSDNMGLNAQAAMMQHSPEHQNQNLYPNQMYPSYPEHNLVMSPAGHSRGSTSVTPKDQH
LTGLQGTCYNQEMVVPRPPQGRKPLSRQNSLPQVGGGYLGGSPHLSPVHSTSSPRRGVRL
PPVQHPQHPQNEMFSPSNNNNNMYYTGQINMNMEKHRDPQNGPCLNQPTNMGPPNLDPAG
DTKSAPMAPYPESSPISNALENLDLENARIDFTSIIDEADSSSFSPVNNPLQGLPGSSSQ
ASSRLTTPQTSVSLTPGTGLSNMAVGDMTSMLTSLAGENKYLNTLS
NT seq 4461 nt   +upstreamnt  +downstreamnt
atgccagtggacatgcagccacatcaggggctgtattactatgagacctcacccagccag
ccctccagaggcattgtgccatcggaccagtctccctacagtgatgtgtctcccctccga
gtcctgcacctcgacggccctccccaggactgccacactatgtacaatcccatgactccc
agtatggctcatggatctggatcaggtccggttcagggaaacagccactgcttggatcaa
tacatgaggcctcctcaggcccttccactgcacaatatgatgggccacaggggcatgcct
cctacagagggtagcaatagcgccccctactgcaaccagaataacatgatgtcgtcacat
cccaacttctgtcagcttcagcccagctctgagcagatcggctctggtgacggctcaagg
ttctccacacctcgctctatgttgaagctgagtaaaaagagagccctgtccatctcacct
ctgtctgatgccagtgtagacctgcagaccgtcattcggacctcgcccaactcgctcgtg
gccttcgttaactctcgctgtaaccccaatggagccagctcctatggtcatctgtctgtg
agcgccatgagcccatctctgaattattccagcaacattaactgccactccagacagcaa
gggtcgatatacggaggaaacggtggcacacctctgggtgttcacacaccaggtccgtgc
caagcttcccgtttaccgccccacaatccccgactcctcgttccacctaagcatggacat
cagctgaaaacagagccaggtctggtaggcgtgatggacggcatgaatgtaaagaacctg
gaggaaaggtcagagggagatgtagccagtccttcctccaccggcactcagcaggatcat
ctgatgggcttgctggatggtagagacgacttggacaaggaggacgggaagccagagccg
gaggccatctatgagaccaactgtcgctgggagagctgcaacaaggagtttgacacacaa
gaccaacttgtacatcacataaacaatgagcacatccacggagagaagaaggaatttgtc
tgtcattggcaggagtgttctcgagagcagcggccttttaaagctcagtatatgctcgtg
gttcacatgcgcagacacacaggagagaagccgcacaagtgcacttttgaaggctgtaat
aaagcctactctcgcctggagaatttgaagacccatttgcgctctcacaccggggagaaa
ccatatgtatgcgaacatgaagggtgcaataaagccttctccaacgcttcagaccgggcc
aagcaccagaaccgaactcactccaatgagaaaccatatgtttgtaagatccctggttgc
actaagcgatacacagatccaagctctttgcgtaagcacgtgaagacagtacatggccct
gaagcccatatcaccaagaagcatcgtggagacacaggcccgcgaccccctggctcagct
ctgacctctggaggccaaacatcggagctgctcctcgaaaaggaggagacatgcagggaa
gactgcaaattgttggcacccgagactgccctgaagtcccagccaagtcctggtgctcag
tcgtcttgcagcagcgaacgttctccactggggagcaccaataacaatgacagtggagtg
gaaatgaacctaaatgcagcaggaagcttggatgatctcacagctttagaggatggagtt
gcaggtggaggaagtggtggaggaggggagccaggaacaatgggaatgtctgcgcaggct
ctgaagcggctggagaacctgaagattgacaagctaaagcaaattcgaaggccgactcct
cctggccgctgtgccagtaacaagcttcctgccatttctggttcaggggacaacatggga
atgtgtgcaccttctccacttaatcgacgagtaatggagctgtccaaccacgagctcgga
gctggaaatatagcaaactctactaatgacaggagaggaagtggtacaagcagcctgagc
tcagcatacacagtgagccgtcgctcctctatggcatccccttacctatctagtagacgc
tccagtgatgtctcacaaataggagggacagcagggggcggctgtcacctcctgagtcca
gaacaagctgggggagaccctctttcacctgaaacctatcgtagaggagctccatgtccc
ggaggtggagggttaccaggtctccccaacttaacacctgctcagcactacagcctgaag
gccaaatatgctgcagccactggcggacctccacccactcctttacctaacatggagcag
tctggtacaccagtaagaaggggggggcctttgagtgagtaccaagggcagcctttacct
cctttcctccagcaaggaggtcctcggcggcacagtgccaacacagaatacggtactgga
gttatctaccctcaccaggctccaggcaacaacaccaggcgggccagtgatccggttcga
tcagtagcagacccacaagctctacccaaacgctttaacagcctcaataatgtggccatg
atgggccgcagaaatgcactacaacttcgtagctctgacacaggtctttcccgccacatg
tactccccacgtccacctagcatcacagaaaatgtaatgatggaagccatgggtatggag
ccccatctcaacactgttgatcccagagatcgttccatgatgatgacccctgtagagaga
aactttatgagtttccagcaacagaatcagacaatgggaggtggaggtccacttccaaac
cagctgtccccgagccatgactctctgggctgcccggatcccgcttacatacagcggcat
taccagggacacggaggagaagtcatatccagagcaagtgggaatccattaagtcaagca
agacctacacagccagatgggatgtcaaatactcttctccaacaggctgagtatggcatg
agcacttgccagctgagtccttccggtccacattacccaggcataggtcagggcagtgac
agtgggggtccttggaatgacaaccacaaccaaatccaaacttcaagccatgcaattcag
aaccagcaatcggtgcggttctcagattccagtttgcagcctcaacaaacacaagctcac
ttcaacaatcagacagccctctacaataattctgatggcactcacaaacctttcatcaag
cccgagcaacagtttcaccctggtatgggtggtggagatgcctgtcagagtgcgaagctc
caacagcaacgtatcctcctgcagcaaacacagacttacccccaacagagtgttcaagtg
ttgatgagaaactctggccacccaagctgtgattttcaagggcagaacccaggttcgtac
cccagtggaggtggcttaagtttgggctgtgccggttctgcgctgtcagaaggccaaagg
tcagaaaccccaatgatgcaggtgaaagagatgatggtgaggaattatgtgcagtctcag
caagcactcatgtgggagcaacaacaagagcaagagcagcagagtggaataaaaccaact
tctctttctgacaacatgggtttgaatgctcaagcagcaatgatgcaacacagcccagag
caccagaatcaaaacctgtatcccaaccagatgtatccctcttaccctgaacataatctg
gtaatgagccctgctggccacagccgagggtccacctcagttacacctaaagatcagcac
ctgacaggtctccagggtacatgctacaatcaggaaatggttgtgccgaggccgcctcaa
ggacgcaagcctctcagccgccagaatagtctgccacaggtaggagggggttaccttggc
ggttccccccacctgagccctgtacactccacttccagccccagacgaggggtgcgactt
ccacctgtccagcatccacagcaccctcaaaatgaaatgttttctccctccaacaacaac
aacaacatgtactatacaggtcagataaatatgaatatggaaaaacacagggacccccag
aatggaccttgccttaaccagccgaccaatatgggaccaccaaacctggacccagcaggt
gacaccaagtctgcccctatggctccctatccagagtctagtcccatctcgaatgcctta
gaaaacctggacttggagaatgctcgcattgactttacttccatcatcgatgaagctgat
tcttcctcatttagtccagtcaacaatcctcttcaaggtcttccaggatcatcctcccag
gcttcttcacgcctcaccaccccacaaacatccgtcagcctgactccaggcactggcctg
tccaacatggctgtgggtgatatgacatccatgcttacctcactggctggggaaaataag
tacctgaacactctgtcttag

KEGG   Xiphophorus couchianus (Monterrey platyfish): 114136826
Entry
114136826         CDS       T05908                                 

Definition
(RefSeq) transcriptional activator GLI3-like isoform X1
  KO
K06230  zinc finger protein GLI3
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:xco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    114136826
Transcription factors [BR:xco03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 GLI-like
    114136826
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 FOXP-CC
Other DBs
NCBI-GeneID: 114136826
NCBI-ProteinID: XP_027860932
LinkDB
Position
21
AA seq 1617 aa
METQSQASSAAEKKKRVETIVATKGSSARTDISEKAVASSTTSNEDESSGTPYHRERRNA
ISSQAQTPGALDRTVNEEPSTSTEERPSLLKKELHSSLPHLSDHALPYRGTLFAMDPRNG
YLDSHYPAPPFFPTFHPPVPIDDRHTQGRYIYEPSPVNPLHVRTPSIATTPAFSDISLIR
ISPQRNPSMGAESPFHPPHPYISPYMDYIRSLHSSPSISVVPAARGLSPADAPHAGLTTA
DYYHQMALLAGHRSPYATDLLPSVASTGSASSATALHMEYLQAMENSRFPSPRLPARPNR
KRPLTISPLSEHSLDLQTMIRNSPNAIVTTLMNSSRSSSSTSGSYGHLSARAISPALSFP
YPPTPVALHVHHQLMGRQPGIVGSAFGHSPPLVHPTPTFVSQRPVPGIPPTGLGAGDRSA
ISNDSSQAKPTSESAVSSTGDPMHHKRSKMKPEDELPSPGAVNVQDHPDGMTLVKEEGDK
DESKQEPEVVYETNCHWENCCREFDTQEQLVQHINNDHIHGEKKEFVCRWEECSREQKPF
KAQYMLVVHMRRHTGEKPHKCTFEGCTKAYSRLENLKTHLRSHTGEKPYVCEHEGCNKAF
SNASDRAKHQNRTHSNEKPYVCKIPGCTKRYTDPSSLRKHVKTVHGPEAHVTKKQRGDYP
RPPPQPREPGGNSQGRSPGQLPLGGYTDQREYNHATSKQDECLQVKSIKTEKPMTSQPSP
GGQSTCSSDQSPISAYPSSGVQLAVSAGRSPGEGLEEDEQEEENEEEVEEECEGEPAPIM
DSTVSTATAAMLTLQARRSIGRPLRWMEHMKMERLKQVNGALPRLGSLSPTPPPKGSAMP
NILGKGSCLGRQWGVPAPQPPAHTELASTELTVLNLLQDRRDSSGSAASSAYLSSSRRSS
GISPCFSSRRSSQASQGDGMMPSQHHRRLHNLSSTDSYDPISTDASRRSSEASQYGGGVV
GGGVGALSGGSCGGGGVGFGGGGGSRGMLNLTPAQHYHLKAKYAAATGGPPPTPLPNMER
MSLKTRMAMMEEGGSNHSLPPLVRPPHCGEDAGRYNNGFMGHGGYRRRVLYPGEGTLNGN
RRASDPVRTQAPETCSLPPVQRFNSLNNLNPLPPLAHNSTAEYRSFSLQNYTRSEGNLQR
GLQHSTNTGSIAENAALEALAMEDDGVAGLFLGDEDILPDDLVQYLHSQDQMGGGSYIQN
EGQILSSQRDNSYPTVEAGVNCTFPESHYLQPQQILERKSPSKLPIQWNEVSSGSVERSP
QRLQSHHMQCERWPEPTTASTGRLRNTLIPQQVSVDFHGSCPQANQSQSTSYVNTGVKLE
TLPNSCMEMRGTSMSNISQGTNGALPQGLKQQMSNGPSKQSHFQQNNSRTMWQIGNNLML
TRASMDSVPNLSQGTVPDHNRPVHAPYPPINNYKNVVKTQQYFNPQSNEIDQHPSQPQQL
QRSGDQCSLVCDVSGLKLENLDHGNMVQTFSDCLTYGSADCKSSSFPVLKEQSLLESMAA
SEGPGSCNGTTNALPSPGTDLVSSTVDGQVSGILDEGVNLDFGAILEDGYDQGSLVSEVL
SPSMFQGLSRTSSRLTTPQGSTTFNSVAPGLSNMAIGDMSSLLTTLAEENKFLAIMQ
NT seq 4854 nt   +upstreamnt  +downstreamnt
atggaaacccagtcacaggccagttcagcagctgagaagaagaagagggtggagaccatt
gtggctacgaagggctcatcggcacgcactgacatcagcgagaaggcagtggcctccagt
accacctcaaacgaagatgagagttcggggacgccataccaccgtgagagacgcaatgcc
attagctcccaggcccagacacccggcgccctcgacagaaccgtgaatgaggaaccctcc
acctccacagaggaacgcccgtccctgctcaagaaggagctgcacagctccctgccccat
ctgtctgaccatgctctgccatacaggggcacgctgtttgccatggacccccgtaacggc
tacctagactcacactaccccgctccaccgttcttccccaccttccatcctcctgtgcca
attgacgacagacacacccagggacgttacatctacgagccatcgcccgtaaaccctctt
catgtcaggactccatcgatagcgaccacgccggctttctccgacatctccctcattcgg
atctccccccagcggaacccgtccatgggggcggagtcgcccttccaccctcctcaccct
tacatcagcccgtacatggactacatccgctccctccacagcagcccctccatctccgtc
gtaccagccgcgcggggcctcagcccggcagatgcgcctcacgccggtctgaccacagct
gattactaccaccagatggctctgctggcgggccaccgcagcccgtacgccacagacctt
ctcccgtctgtggcgtccaccggcagcgcgagcagcgccaccgccctgcacatggagtac
ctgcaggcgatggagaattcgcgcttcccaagcccaaggcttccggcacggcccaacagg
aagcgccccttgaccatctctccgctctctgagcacagcctcgatttgcagaccatgatt
cgtaactccccgaacgccatagttaccacactgatgaacagctcacgctccagctcctcc
accagcggctcctacggacatctctccgccagagcaatcagcccagctttgagcttcccc
taccctccaactccggtggcgttacatgtccaccatcagctgatgggccgccagcctggg
atcgtgggctccgccttcggccacagcccgccgttagtccaccctacgccgacctttgtc
agccagcgtcccgtgcctggcatccccccaactggtctcggcgccggcgatcgctcagcc
atctccaacgactcatcacaggccaaaccgactagcgaatcagctgtgagcagcaccggc
gacccgatgcatcacaagcggtccaaaatgaaaccggaggatgagttgcccagtcccgga
gcggtgaatgtgcaggaccatcctgatgggatgactctggtgaaggaggaaggcgacaaa
gacgagagcaaacaggagccggaggtggtttatgagacaaactgccactgggagaactgc
tgccgtgagtttgacacccaggaacagctggtacaacacatcaacaatgaccacatccac
ggagaaaagaaggaatttgtgtgccgatgggaggaatgctctcgagagcagaagcccttt
aaggcacagtacatgctggtggttcacatgcgcagacatactggggaaaaaccacacaag
tgcacatttgaaggctgcactaaggcctactcacgcctggaaaacctgaaaactcactta
cgttcccatactggtgagaaaccttatgtgtgcgaacatgaaggctgtaacaaggctttt
tccaacgcgtcggatcgggccaagcatcagaaccgaacacactccaatgagaaaccgtac
gtgtgcaaaatcccgggctgcactaagcgctacacagaccccagctccttacggaagcac
gtaaagacagtacacgggccagaggcgcatgtcaccaagaaacagcgtggcgattatcca
cgccctccacctcagccccgggaacctggaggcaacagccagggcaggtcacctggacag
ctgcccctgggtggatacacggaccaaagggagtacaaccacgctacctcaaaacaagat
gaatgtctacaggtgaaatctatcaagacagagaagccaatgacgtctcagccaagccct
ggcggtcagtctacatgcagcagtgaccagtcccccatcagcgcctatcccagcagtgga
gtccagcttgctgtgagcgccggacgctcgccaggggaggggctggaggaggacgagcag
gaagaagaaaatgaagaggaggtggaggaagagtgcgagggcgagccagcccccattatg
gactccacggtgtccacggccaccgcggccatgctgaccctgcaggcgaggcgaagcatc
ggccggcccctgcgctggatggagcacatgaagatggagaggctaaagcaggtgaacgga
gcgctgcccaggcttgggtccctgtctcccacaccaccccctaaaggttcggcaatgccc
aacatcctggggaagggatcgtgcttgggcaggcagtggggggtgcctgctcctcagcca
cctgctcacactgagttggccagcacggagctaacagttctcaatttgctccaagaccgg
cgcgatagcagcgggagcgccgccagttcagcctacctgagcagcagccgacgctcttcg
ggaatctctccctgcttctccagtcggcgctccagccaggcttcccagggtgatggcatg
atgccgtcccagcaccaccgacgcctccacaatctcagctccactgactcttatgacccc
atctccacagacgcctcccgccgatccagtgaggctagccagtatggaggtggagtagta
ggaggaggcgttggagcactctcaggtgggagttgtggaggcggaggagttggcttcgga
ggaggaggcgggtcacgagggatgctcaatttaacccctgcacagcattaccaccttaag
gcaaagtacgcagcagctacaggtggcccacccccaacgcctctacccaacatggaacgc
atgagtctgaagacccgcatggccatgatggaggagggtggcagcaatcacagtctaccg
cctttagtccgaccaccccattgtggtgaagacgctggaaggtacaacaatgggtttatg
gggcacggaggttatagaaggagggttctttatcctggcgagggaactctgaatgggaac
cgaagggcgagtgacccagtgcggacacaggctcctgaaacttgtagtttgcctccagtt
caacgattcaacagccttaataatctcaatcctcttcctcctctggctcataactctaca
gctgaatatcgaagttttagccttcagaactacacacgctcagagggcaacctgcagaga
ggcctgcagcattcaacaaacactggcagcattgcagaaaatgcagccttggaagccctg
gcaatggaggatgatggtgtagccggcttatttcttggagatgaagatattttgccagat
gatttggtgcagtatctgcactcccaagatcagatgggtggtggttcatacattcaaaat
gaagggcagatactttctagccaaagggacaactcctaccccactgttgaagcaggggta
aactgtaccttccctgaatctcactatctccagccgcagcagatactagagaggaagagt
cctagtaagcttcccattcagtggaatgaagtaagctcaggtagtgttgagaggtctccc
caaaggttacaaagccaccatatgcagtgcgagaggtggcctgagccaacaactgcatca
actggtaggttacgaaacacgctaattccccagcaggtgtctgtggacttccacggcagc
tgcccacaggccaaccagtcgcaaagtactagttatgttaacactggggtgaagctggag
acactgcccaactcctgcatggagatgagaggtaccagcatgtcaaacatctcacagggt
accaatggggctcttcctcaaggtcttaaacagcagatgtctaatgggccttcgaaacag
agtcatttccaacagaacaacagcagaaccatgtggcagattggaaacaacctcatgctt
acccgggcctccatggacagtgtacccaacttgtcccagggaaccgttccagatcacaat
cgaccagtacatgctccatatccaccaataaacaattacaaaaatgtagtcaaaacccag
cagtacttcaatccacagtcgaatgaaattgaccaacaccccagccaaccccaacagcta
cagaggagtggagaccagtgttctcttgtgtgcgatgtatcagggctaaaactagagaac
ctagatcatggaaacatggtacaaaccttttcagattgtctcacttacggatcagccgac
tgcaagtcctcttccttccctgtgttgaaagagcagagtttgttagagtccatggcagca
tctgagggaccaggcagctgcaacggaaccacaaatgcccttccctcccctggtacagac
ctagtcagtagcacagttgatggccaagtttcaggaatattagacgaaggggtaaatctg
gactttggtgccatcctggaggatggctacgatcagggtagcctggtctctgaggtactg
agcccctctatgttccagggcctgtcgaggacctcatcacgcctcaccacacctcaagga
tccaccaccttcaacagcgttgctcccggtctcagcaacatggccattggagacatgagt
tccctcctcaccaccctcgccgaggagaacaagttcttagctataatgcaatag

KEGG   Xiphophorus couchianus (Monterrey platyfish): 114140508
Entry
114140508         CDS       T05908                                 

Definition
(RefSeq) zinc finger protein GLI2-like
  KO
K16798  zinc finger protein GLI2
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:xco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    114140508
Transcription factors [BR:xco03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 GLI-like
    114140508
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 FOXP-CC
Other DBs
NCBI-GeneID: 114140508
NCBI-ProteinID: XP_027866263
LinkDB
Position
24
AA seq 1328 aa
METSSPPAAQKKDKMDGSSFSDLPKKPSPSETRAPQHLFPTFHTPIPINIRHHEGRYHYE
PHALHAMHSPAGLTGSPVISDISLIRLSPGAMATSESPFSPPHPYVSPHMEHYLRQVHGS
PTLSMISAARGLSPADLAHEHLKERGLFGLPPPPPPPPPGAGAAEYYHLMANHRSPYGEL
LLPGPGAPLADYLSPVDVSRFSSPRLTPRLSRKRALSISPLSDASIDLQTMIRTSPNSLV
AYINNSRSSSAASSSYGHLSVGGLSPSFPFPHPINPMAYQQLLSQQRGLSAFGHNPPLVH
PPPTFSSRQQGLGLSCLPTSTHNNDVSSKNHGGDSAVSSSVDPINKRSKVKAELDGMKPG
SPLSPNQYSGAQDLKEDVERDECKQEAEAVYETNCHWDGCSQEYDTQEQLVHHINNDHIH
GEKKEFVCRWDDCSREQKPFKAQYMLVVHMRRHTGEKPHKCTFEGCSKAYSRLENLKTHL
RSHTGEKPYVCEHEGCNKAFSNASDRAKHQNRTHSNEKPYVCKIPGCTKRYTDPSSLRKH
VKTVHGPEAHVTKRQRSDLPPRPPRENGENERAGRLHREDKLLENSSPRVTEEYLHMKSI
KTENPVMHQSSPGGQSSCSSEPSPLGTNNDSGVETAAHSGGSLGDLSALDDLPFLDSVDF
SGGVAAVGLHLRKQLSGSQCLENLKKEKLKAVRDSCRWANNPTPPAYQGTTLPPIPTSGS
LLENSSLCGDPASFPGSGKMTLLGNLSERRDSTSSTFSSVYTLSRRSSGISPGFSSRRSS
QTSQFAANRLTNISSADSYDPISADISRRSSQASQFGGSNSGPGAASPLTLTPAQHYRLK
AKYAAATGGAPPTPLPYPDQSCLKDFNEYSSKNSLRSLQFSKERSLMPHEVPSNIPRRAS
DPVRPLDPLNQPPLHRFNSMVSLNRRVSLQPHPPPAKDHRRLSQQVYAQPNVSPRGFPHS
LQPASISEDITMQTRRCNGNPSGQGDFHGAGSGQQLYHQRRMDGAKRSPLMSPSSPHGSA
ASGQWNMDTTQQYTRLDPRGNLIVVQQNQNAGSFSGTSHQQIVQHFNNRCMKPGQHHFQQ
SSNLNEASSPQHRFSQSSYDRNGKAPYPPCGNILHCKEEPVDMDFGQLQPAQIKTESFDS
STMTLDQQNCNMTGFRTGNQNHPQLRPPTEPNSPNVSIPKVLTPPDDSQLSSSRVSELSY
ISEDNALFYTGQIRVLEPNGNLDCHVSLLVSSPSAAPLDNQGSRTAPEHPQIDFDSMLDD
GDHSSLMSGTLSPGLLQSFSQSSSRLTTPRSSVTLPSVPTGTGNMAVGDMSSLLSALAEE
NKFLNLIS
NT seq 3987 nt   +upstreamnt  +downstreamnt
atggagacctcgtcaccgccagccgcacagaaaaaggacaaaatggacggcagcagcttc
agcgacctccccaagaagccgtcgccctcggagaccagagcgccgcagcacctcttcccc
accttccacacgccgatccccatcaacatccgccatcatgagggccggtaccactacgag
ccgcacgcgctgcacgccatgcacagccctgcaggtctgaccggcagccccgtcatctct
gacatctccctgatccgcctgtcgcccggcgccatggcgaccagcgagtcgccgttcagc
ccgcctcacccgtacgtgtcgccccacatggagcactacctgcgccaggtgcacggcagc
cccaccctgtccatgatctcagccgccagaggcctcagcccagcagacctggctcatgag
catctgaaggagcgcggcctgttcggccttcctcctcctcctcctcctcctcccccgggg
gccggcgcggcggagtactaccacctgatggccaaccaccgcagcccctacggcgagctg
ctgctgccggggcccggggccccgctggccgactacctctctcctgttgacgtgtcccgg
ttctccagccccagactgacgcccagactcagcaggaagagggcgctgtccatctcgcca
ctgtccgacgccagcatcgacctccagaccatgatcagaacttcgcccaactccttggtg
gcgtacatcaacaactcgcggtccagttcagccgccagcagctcctacggacacctgtcg
gtcgggggactcagcccgtcgtttcccttccctcaccccatcaaccccatggcctaccag
cagctcctgtcccagcagcgcggcctcagcgccttcggccacaacccgcccctcgtccac
cctccacccactttctccagtcgccagcagggcctcggcctctcctgcctgcccacctcc
acccacaacaacgacgtgtcgtccaagaaccatggaggagactctgctgtcagcagctcg
gtggatcccatcaacaaacgctccaaagtgaaggcggagttggacggcatgaagccggga
tctcctctgtcaccgaaccagtacagcggcgctcaggacctgaaggaggacgtggagcga
gacgagtgcaagcaggaggccgaggccgtttacgagaccaactgtcactgggacggctgc
agccaggagtacgacacgcaggagcagctggtgcatcacatcaataacgaccacatccac
ggagagaagaaggagttcgtgtgccgctgggacgactgctcgcgggagcagaagcccttc
aaagcgcagtacatgctggtggttcacatgcgccggcacacgggggagaaaccacacaaa
tgcacgttcgagggctgctccaaggcctactcccgcctggagaacctgaagacccatctg
cgctctcacaccggggagaaaccctacgtctgcgagcacgaaggctgcaacaaggccttc
tccaacgcctcggaccgggccaagcaccagaaccggacgcactccaacgagaaaccgtac
gtgtgtaaaatcccgggctgcaccaagcgctacacggaccccagctctctcaggaagcac
gtgaagacagttcacggcccggaggcccacgtcaccaagaggcagcgcagcgacctgccg
cccagaccccccagggagaacggcgagaacgagagagccggcaggctccacagggaggac
aagctgttggagaacagctcccccagagtcacggaggagtacctgcacatgaaatccatc
aagacagaaaaccctgtgatgcatcagtccagtcctggcggtcagtcatcatgtagcagc
gagccgtcaccacttggcaccaacaatgacagtggagtagaaacagcggcgcacagcggg
gggagcctgggggacctcagcgcgctggacgacctgccgttcctggactctgtggatttc
tccggcggggtcgcagcggtcggcctccatctcagaaagcagctgagcggcagccagtgc
ctggagaacctcaagaaggagaagctgaaggcggtacgggactcgtgtcggtgggccaac
aacccaacaccccctgcttatcaagggaccacgctgccgcctataccgacaagcgggtcc
ctcctggaaaattcaagcctgtgtggagatccagcctccttccccggctctggcaaaatg
actctgctgggaaacctttctgagcgcagagacagcacttccagcaccttcagctcagtc
tacacgctcagccgccgctcctcaggcatctcccctggtttctccagtcgacgctcgagc
caaacttctcagtttgctgccaaccggctgacgaacatcagctcagcggactcctacgac
cccatctctgctgatatttctcggcgctccagtcaggccagtcagtttggggggagtaat
agtgggcctggggctgccagccctctcaccctgaccccagcccagcactaccgactgaag
gcaaagtatgctgctgcaactggtggcgcacctcctacacctcttccatacccggatcaa
tcatgtctgaaggatttcaatgagtactcgtccaaaaacagcctccgatccttacagttc
agcaaggaacggagcttgatgccccatgaagtaccttccaacattccccgtcgagccagt
gaccctgtgagacctttagatcctctcaaccagcctcctctacatcggttcaacagcatg
gtctcactcaaccgaagggtctccttgcagcctcatccccctcctgcaaaagatcacaga
cgcttatcccagcaagtgtatgcacaaccgaacgtcagtccccgtggtttccctcacagc
ctacaaccagcaagcatttcggaggacatcaccatgcagacaagaaggtgcaatggaaat
ccctctggtcaaggagatttccacggagctggcagcggccagcagctgtaccaccagaga
cggatggatggggcgaaaaggagtccactcatgagtccatcctcaccacacggcagtgct
gctagtggacagtggaacatggacaccacccagcagtataccaggctagatccacgtggg
aatctgattgtcgtccaacagaaccagaacgctgggtctttcagtgggacctcccaccag
cagatagtccaacacttcaacaacagatgcatgaaacctggacagcaccacttccagcag
tcctcaaacctcaatgaagcttctagccctcagcacaggttcagtcaaagttcctatgac
aggaatggcaaggctccgtatccaccctgtgggaacatcctgcactgtaaggaggagcca
gttgacatggactttggtcaactccagcctgcgcagataaaaactgagagttttgattca
tccaccatgactttagaccagcagaactgtaacatgactggtttccggactgggaatcag
aaccatccccagctgagaccaccaacagaacctaactctccaaatgtctcaataccgaag
gtgttgacgccaccagatgattcccagctctcctctagtagagtttctgaactctcttac
atctctgaggacaacgctctgttctacacgggtcagatccgagtcctggagcccaacggg
aacctggactgtcacgtttcccttctggtgagttctccttcagctgctccactcgacaac
caggggagtaggactgcacctgagcaccctcagatagactttgatagcatgttggacgat
ggggatcactccagcctcatgtcaggaaccctgagtccaggacttctccagagtttctcc
cagagttcgtctcgcctcacgacgccccggagctcggtgacactgccctcagtcccgacg
ggaaccgggaacatggccgtcggggacatgagctcactgttgagcgccctggctgaggag
aacaagttcctcaacctgattagctaa

KEGG   Xiphophorus couchianus (Monterrey platyfish): 114147937
Entry
114147937         CDS       T05908                                 

Gene name
gli2
Definition
(RefSeq) zinc finger protein GLI2 isoform X1
  KO
K16798  zinc finger protein GLI2
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:xco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    114147937 (gli2)
Transcription factors [BR:xco03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 GLI-like
    114147937 (gli2)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 FOXP-CC zf-C2H2_aberr
Other DBs
NCBI-GeneID: 114147937
NCBI-ProteinID: XP_027878556
LinkDB
Position
7
AA seq 1456 aa
MDKKEVKGSGPDGSSFSENPKKPLPTGMSRGAHHLFPFHSPIPIDTRHHEGRYHYEPHPL
HAMHSAPGLTGSPVITDISLIRLSPHATAGTGESPFSLPHPYVSPHMDQYLRSVHGSPTL
SMISAARGLSPAEVTHEHLKDRALFSFPPPPPGANPSEYYHLMASASQRSPYGDLLIQNG
AATAVHLPDYIGPVDVSRFSSPRLTPRLNRKRALSISPLSDASIDLQTMIRTSPNSLVAY
INNSRSSSAASSSYGHLSVGGLSPTFSFPHSLNPVAYQQLLSQQRPLNAFGQTAPILQPP
PPSFPARQHPNAASSMSAEVNQSSGGDPAVSSTVNPLNTKRTKVKTEAEGPVPISPSAQD
HAAGVLDLSEDLDKDECKQEPEAIYETDCHWEGCGREYDTQDQLVHHINNDHIHGEKKEF
VCRWEDCSRELKPFKAQYMLVVHMRRHTGEKPHKCTFEGCFKAYSRLENLKTHLRSHTGE
KPYVCEHEGCNKAFSNASDRAKHQNRTHSNEKPYICKILGCTKRYTDPSSLRKHVKTVHG
PDAHVTKKQRSDAPPRLPPRGNGENEAKHGPAGADGKTEANGASRGDERLQVKPIKMEDS
VMHQSSPGGQSSCSSEPSPLGSANNNDSGVEMAMYSGGSFGDLSAPDEGPTVDSTIPAGV
PQVGMGLQLRKSVAHGGAVTIKLENIKQERLKAVRETCSWATSRPQGMKLPPIPAAGSLL
ESSIMTSSLCTPYTGQPTGELTSCDITLLNQLNDRRDSTTSTISSAYTFSRRSSGISPCY
SSRRSSEASQFGTNRHNNISSADSYDPISTDLSRRSSEASHCGGGVASGGALPSLLSLTP
AQHYRLKAKYAAAIGGAPPTPLPNMDRMSLRTRMALYSDCQEGSTFLQPATGDAPRRCSD
ITYGSHSMMPHEVPTNLPRRASDPVCRPPLDPLSLPRVQRYSSMNNVNPMNALSSAERHQ
ALAMQGYTRSDGSLQRYPFAPRPPSISENIAMETMAVDGLMSSGEQSAEDEIVLPDDVVQ
YLRSQSSGPTSHSYNSQGYQASMAPPLHFHGQRRMAMVDATLSQSGHDISYQGGVNGSQQ
LVPAPRDNKSNMPVQWNEVSSGTMDTKLPKPQQHPFRSNLASAQQRHSSGVLHALSGNQQ
VVPISHNLSIQGYHSHQSPGNTSLQHHQQQRQCSFNEHMSHQQELSQEGRLRSLSGSSSI
ALNIAASSELQSFKTRAQVDGYCHGNQVNQEQNYSIPLKKQQYVIQNGARRMLQPQPPNE
PKSFPRQHSASAMTQPSPRLVELNPSNICSEASPKRQSQGLNHSSPVNQNSAVFYLAQIH
MFQPSSHSSDDDSMSPSANEATCSDMAAAASMASPGANQVSSSIVDSSTGRSRATEHTQI
DFDTMLDDGDHSSLMSGTLSPGLLQSLSQSSSRLTTPRNSITLASVPAGIGNMAIGDMNS
LLTALAEESKFLNFIS
NT seq 4371 nt   +upstreamnt  +downstreamnt
atggacaaaaaggaggtcaaaggttctggtccggatgggagcagcttctccgagaatcct
aagaaaccgttgcccaccggcatgagcagaggtgctcaccaccttttcccgttccacagc
cccatccccatcgacaccaggcaccatgagggccggtaccattatgagccacacccgctc
cacgccatgcacagcgccccaggactgacaggaagtccagtcatcacagacatttctctg
attcgactctcgccacatgccacggctgggaccggcgagtcaccgttcagcctgccccat
ccatacgtcagccctcacatggaccagtacctccgctcagtccatggcagtcccaccctg
tccatgatctcagcggcacgaggactgagcccagctgaagtgacccacgagcatctgaag
gaccgggccctgttcagcttcccccctccaccgccgggggccaacccctcggagtactac
cacctgatggccagcgccagccagagaagcccctacggcgacctactgatccagaacggc
gcagccacagcggttcatctgccggattacatcggccctgtggacgtgtcccgtttctcc
agcccaaggttgactcctcggctgaacaggaagagggcgctgtccatctccccgctgtcg
gacgccagcattgacctgcagaccatgattcgcacgtcgcccaactccttggtggcctac
atcaacaactcgcgctccagctcagcagccagcagctcctatggacacctgtccgtggga
ggactcagcccgaccttcagcttcccccactccctcaaccctgtggcctaccagcagctg
ctgtcccagcagagaccgctcaacgccttcggtcagacggcccccatcctgcagccacca
ccgccctctttccccgcccgccagcaccccaacgctgcgtcctccatgtctgcagaggtg
aaccagagctccggtggagatccggcggtcagcagcacagtcaatccgctgaacaccaag
aggaccaaggtgaagactgaagcagagggtccagttcccatttcaccgtccgctcaggac
cacgccgcaggagtcctggacctgagcgaagatctggacaaggacgagtgcaagcaggag
ccagaggccatttacgagaccgactgccactgggagggctgcggcagggagtacgacacc
caggaccagcttgtccatcacatcaacaacgaccacatccacggagagaagaaggagttc
gtgtgccgctgggaggactgttcccgggagctgaagcccttcaaggcccagtacatgctg
gtggtccacatgaggagacacaccggcgagaagccgcacaaatgcacgtttgagggatgc
ttcaaggcttactctcgcctggagaacctgaagactcacctccggtcccacaccggtgag
aaaccatatgtgtgtgagcacgaaggctgcaacaaggctttctccaacgcctcggacagg
gccaagcatcagaaccgcacacactccaatgagaaaccatatatctgtaaaatcctgggc
tgcaccaagcgctacaccgaccccagctccctcaggaagcacgtcaagacggttcacgga
cccgacgcccacgtcactaagaagcagcggagcgacgcgccacctagactgccccctaga
ggaaatggggagaacgaggccaagcatggcccggcaggcgcagatgggaagacggaggcc
aacggtgcatccagaggagacgagcggctgcaggtcaaaccaatcaagatggaggactct
gtgatgcatcagtccagtcctggcggccagtcatcgtgcagcagcgagccgtcgcctctt
ggcagcgccaacaacaatgacagtggggtagagatggccatgtatagcgggggcagcttc
ggggacctcagcgcgccggatgagggtcccacagtcgactccacgatccccgccggggtg
ccgcaggtgggaatggggcttcagctgaggaaatcggtggctcacggaggagcggtcacg
atcaagctggagaacatcaagcaggagaggctgaaggcggtgcgggagacctgcagctgg
gctaccagcagaccacagggcatgaagcttcctcccatccctgcagctggttccttgctg
gagagctccatcatgacgagcagcctctgcactccgtacactggccaacccactggggag
ttgacctcctgcgacataacgctactgaaccagctcaacgaccgccgcgacagcaccacc
agcaccattagctcagcctacaccttcagtcgacgctcctccggcatctcgccctgctac
tctagccggcgctccagcgaggcatcccagtttggcactaaccgtcacaacaacatcagc
tcggctgactcgtatgacccgatctccaccgatctgtctaggcgctccagtgaggccagt
cattgtggtgggggtgtggctagtggaggagccctgcccagccttctgagtctaacccca
gcccagcattatcggctcaaagcgaagtacgctgccgctattggcggtgctccacctact
cctctccccaacatggatcgaatgagcctgaggacaaggatggctctatacagtgactgt
caggaaggctccaccttcctccagccggccaccggcgatgcaccccggcggtgcagcgac
atcacctatggctcacacagcatgatgccccatgaagttccgaccaacctcccacgtcgg
gcaagtgaccccgtctgccgtccacccctagacccgctgtctcttccaagggttcagcgc
tacagcagcatgaacaatgtgaaccctatgaatgccctgtcatctgccgagcgccatcag
gcattggctatgcagggttacacacgctcggatgggagtctccagcgttacccgttcgcc
ccaagaccgccaagcatttctgagaacattgccatggagaccatggcagtcgacgggctg
atgagcagtggggagcagagtgcagaggatgagattgtgcttccagatgatgtggttcag
tacctgaggtctcagagttctggcccaacaagccacagctataacagtcagggctaccaa
gccagcatggctccaccgctgcactttcatggccagaggaggatggccatggtggacgcc
accctgtcacagtctggtcatgacatttcctaccaggggggtgtcaatggttcccagcag
ctcgtcccagcaccacgagacaataagagcaacatgccagtgcagtggaacgaggtgagc
tccgggacgatggacaccaaactccccaaacctcagcagcatcccttcaggagcaacctg
gcttccgctcagcaaaggcacagctctggggtgctacatgccctgagtggcaaccagcag
gtcgtcccaataagccacaacctctctatacaggggtaccacagccaccagagcccgggg
aatacctccctccagcatcatcagcagcagagacaatgcagctttaatgagcacatgagt
catcagcaagagctcagtcaggaaggaaggcttcgttcgttatctggaagctctagcata
gccctcaacattgcggctagctctgagctgcagagctttaagaccagagcccaggtggac
gggtactgtcatgggaaccaagtgaaccaggagcagaactacagcattcccctcaagaag
cagcagtatgtgatccagaacggagccagaaggatgttacaaccccagccacctaacgag
cccaagtccttccccaggcagcactcagcctctgccatgacacaaccaagccccaggcta
gttgaactgaaccccagtaacatctgctctgaggcaagcccaaagaggcagagccagggg
ctgaaccacagcagcccagtcaaccagaactctgctgtgttttacctggctcagattcac
atgtttcagccttcgtctcacagcagtgatgatgactcaatgtccccaagtgccaatgag
gccacctgtagcgacatggctgctgcagccagcatggcctctccaggagccaaccaggtc
tccagcagtatcgttgactcgtccaccggccggtccagagccacagagcacactcagatc
gacttcgacaccatgctagatgacggagatcattccagcctgatgtctgggacgctgagt
ccagggcttctgcaaagcctgtctcagagctcctcccgtctcaccacgccacgcaattcc
atcaccctggcgtccgtcccagctgggatcggcaacatggccattggagacatgaactcc
ttgcttacagctctggctgaagagagcaagttcctcaacttcatcagttga

DBGET integrated database retrieval system