KEGG   Xiphophorus couchianus (Monterrey platyfish): 114135756
Entry
114135756         CDS       T05908                                 

Gene name
evc2
Definition
(RefSeq) limbin
  KO
K19608  ellis van creveld syndrome protein 2
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:xco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    114135756 (evc2)
Chromosome and associated proteins [BR:xco03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other cilium assembly proteins
    114135756 (evc2)
SSDB
Motif
Pfam: EVC2_like
Other DBs
NCBI-GeneID: 114135756
NCBI-ProteinID: XP_027859108
LinkDB
Position
20
AA seq 1339 aa
MFRVHLIAQRRTLCSFFLHIKVLCLFSLSLNVACGHNVKLRAGVTEDNGEHYCCNGTKWD
TTPFTSGKCGNLCTLHATHQDQGGTSADLTMLRINGKMDNGLLSVYGWDPSLSSASLGPW
EHSIYSPFSYISNMVHLRKSRSTLIRHTPHQPPPQVQNVVPPSFFEVRFYKCAQVKLDTD
PPQLTFFLLIHNLSPLGGTNLSQVAIRDSISGIKPIKTEGRVVERGYQTFAIDSLLAGSH
VVVNYTAHVRSHNNELLDLPAFLTFSNASQNDVSMFGPLRANLTLRVNSTDKIYPNHGVH
FAGFVAGFFITLVLLLLGVLAIKFTSSRERFCLFQRKRIRCQLDPEYAESSMSETIKDEA
AFEDKMVDVMVLEDPQNMYQALDNLETSSLLQASSNLEATRIQMYKDLMSCLLGGLLSRG
QISAQAQQRLLSVVHGQLLGMEGRLKEERGARMAALAGQCNLETHEEMEAEHQEQAAEKA
EAERLRQHADQQEFLQCSRLLEKLHKQRQSHLRRVLLVQREDASAKVQREIIEWRRVELH
KIFSEELEEATRMGELEKSTAKRLQHEYFTCQDQLEEVLDVVVANQRYVLTERSAQRKFL
VHSLHSLEDLISEMFSSASSNLDSWFSHIKSGSAVPSEQLNQLQEKAQKDLVMVRQRLDE
TLNQEKRAMRCGLINKRRELISNMLRVHKQRQRDLSSITKSLEEKMDEAHHLQCWQNLLT
ARSLELAELINSLDEEAAADIRKVTMRGIQGVMADVKAIQPSAAQAVLTLLPPGAKHPVL
QEEPEAGSGKSAGQGAGALLQGQERLHREGKAALRTLSCTRESLQEGMEQELREQKELRA
HWRDFFRCLCSSQLTLSEDDRLRMKLEFQKSLSVIDRCLVLPHAVSRSKLHAALAEWRAK
SEEEMENMQSKGRSTEARKKADTSEVVRFQKRLQDRIDLFEKEREMENSVMNKVMEEMQR
ERDDYLLCQADNLAMQMATVIFQKAERWAKVLETSKAMVTLQSQLIQQLRERNVSELQDM
AQSIHSHCLSLEEAEQQLQSERTELDRLGVLSLKIQTVFEGEEAREEDDVFELQPDCSMT
PILQDALHKCEQVIALTFERFQEISTSNQVKEELKEQIELKRLYSNCDQDLEFASQLVKQ
SRVSDDVLLEVLRLLLPSLPESELLSLSDALCRKQHPVSAFTEQEHSGCAGEQNRAVPVR
LREIAVRKIIINTPNGAVERERLEEKRLSAVEKLLPRSRLLRPRDAGPLLADDIGARDVL
TPAALVPQLRSDTEETAHGPAGESVTSDSACGAVGSLATGERLFVFRDPPESNNSVVVPE
RKKKRNFLNFKKGSVAPAT
NT seq 4020 nt   +upstreamnt  +downstreamnt
atgtttcgggtacacttaatcgcacaaaggcgcacattatgctcgtttttcttgcatatc
aaagttttgtgtttgttttcgctctctttgaatgttgcctgcggtcacaacgtcaaactg
cgcgccggtgtcacggaggacaatggtgaacattattgctgtaacggtacaaaatgggac
acaacaccttttacctcagggaaatgtggcaacctctgcacccttcatgcaacgcatcaa
gaccaaggaggaacgtcagccgacctaacgatgctcaggattaatggtaaaatggacaac
gggctcctgtctgtttatggatgggacccatctttgtcgtcggcttccctagggccatgg
gaacactccatttactccccctttagctacatttcaaacatggtgcacctcagaaagagc
agaagcacactcatcagacacaccccacaccagcctcctcctcaggttcagaatgttgta
cctccatctttcttcgaggttagattttataagtgtgcccaggtgaagctcgacaccgac
cccccccagttgacgttcttcctgctgatccacaacctgagccccctgggtgggaccaac
ctgtctcaggtggccatacgagactccatatctgggatcaaacccatcaaaactgaaggc
agggtcgtcgaaagaggctaccagacgtttgctatcgattcactgctggccggatctcat
gttgtggttaattacactgctcacgtaaggagtcacaataatgagctccttgatcttcct
gctttcctgaccttctctaatgcatcacagaatgacgtcagtatgtttgggccactgaga
gccaatctgacactgagagtaaattcaactgataagatttatcccaaccatggagtccat
tttgctggatttgttgctggtttctttatcacattggtgctgctgttgctgggggttctc
gctattaaattcactagttccagagaaagattttgcctttttcagcgaaagagaatcaga
tgtcagttggaccctgagtatgcagagtccagcatgagtgagacaatcaaagatgaggct
gcatttgaggacaagatggtggacgtcatggtgctggaggatccacagaacatgtaccaa
gctctggataaccttgaaacgtcttccctgctacaagcctccagtaacctggaggccacc
cgcattcagatgtacaaagacctgatgtcctgcttgcttggggggctgctgtcacggggc
cagatcagcgcccaggcccagcagaggctgctcagtgtggttcatggtcagctgctcgga
atggagggccgcctgaaggaagaacggggcgcccgcatggctgccctggctggacagtgt
aacctggaaacgcatgaagagatggaggcagagcatcaggaacaagcggctgaaaaggcc
gaggccgagaggcttcgtcagcatgcggaccagcaggagtttctccaatgcagccgcctc
ctggagaagctgcacaagcagaggcagagtcaccttcgccgcgtcctcttggtccaacgt
gaggacgcttcggcgaaagtccagagagagatcatcgagtggcggcgggtggagctgcac
aagatcttctccgaagagctggaggaggccacgaggatgggcgagttagagaagagcaca
gcaaagagactgcagcatgagtacttcacttgtcaggatcagctggaggaagtgctggat
gtggttgttgccaatcagcggtacgtcctgactgaacgcagcgctcagaggaagttcctg
gtgcacagcctgcacagcctcgaggacctgatctctgaaatgttctccagcgcctccagc
aacctggacagctggttctcccacatcaagagtgggagcgctgtaccttcagagcagctg
aatcagctgcaagaaaaggcccagaaagacctcgttatggtgaggcaaagactagatgag
accctgaaccaggagaagagagcgatgcgctgtggactgatcaataagaggagagagctc
atctcaaacatgttgagggtccacaagcagagacagagggatttatccagcattaccaaa
agtctggaagagaagatggacgaagcgcaccatctgcagtgttggcagaacttactgacc
gctcgcagcctggagctcgcagagctcatcaacagtctggatgaggaggctgctgctgac
atccgcaaggtgacgatgcgagggatccagggagtgatggctgatgtgaaagccatccag
ccttccgcggctcaggccgtgctgacgctgctgccgccgggtgccaaacaccccgtgctg
caggaggaacccgaggcggggtctggcaagtctgcagggcaaggggctggtgctcttctg
cagggccaggagaggcttcatcgggaaggcaaggcagcgctgcgcaccctcagctgcacc
agggagtctctgcaggaaggcatggagcaagagctgcgggaacagaaggagctcagggct
cactggagagatttctttcggtgtctgtgttcgtctcagctgacgctgtctgaggacgac
cggctgaggatgaagctagagtttcagaagagtctgtctgtcatagatcgctgtctggtg
cttccccacgccgtctccagatctaaactccacgctgctctggctgaatggagagcaaag
agcgaagaggagatggaaaatatgcaatcaaaggggagaagcacagaggccagaaagaaa
gcagatacatctgaggtggtgcgtttccaaaaacggctccaggacaggattgatctgttt
gagaaagaaagggaaatggagaacagtgttatgaacaaggtgatggaggagatgcagagg
gagagggatgactatctgctctgtcaggcagacaacctggcaatgcagatggctacagtc
atcttccagaaggctgagcgatgggccaaagtgttggagacgtccaaggccatggtcacc
ctgcaaagccagctcatccaacagctcagggagagaaatgtctcagaactacaggatatg
gctcagagtatacacagccactgcttgagcctagaagaagcagaacaacagcttcaatcg
gagaggacagagctggacaggctaggagtactgtcactcaagatccagactgtctttgag
ggagaggaggccagagaggaagatgacgtgttcgagctccagcccgattgcagcatgacg
cctattctccaggatgcgcttcacaagtgtgagcaggtcattgctttgacgtttgaaagg
tttcaagagatttccaccagcaatcaagtcaaggaagaattaaaagaacagatcgagctc
aaaaggctttactcaaactgtgaccaggatctggagtttgcctcccagctggtgaagcag
agtcgcgtctctgacgacgttctcctggaggttctgcgtctcctcctcccaagtctgccc
gaaagtgaacttctctcgctcagcgacgcgctctgtcgcaaacaacatcccgtttctgct
tttacagagcaagaacactctggatgtgccggggagcagaacagagccgttcctgtcaga
ctgagagaaattgcggtgcggaaaatcatcattaatacgccaaacggcgctgtggaaaga
gagaggctggaggaaaagagactgagcgcggtggaaaagctgctccctaggtcccgtctc
ctgcgtcccagagatgccggaccgttgctagctgacgacataggagctcgggatgttttg
acaccagccgcacttgttccgcagctgcggagcgacacggaggaaacggcgcatggcccc
gcaggggaaagcgtaacctcagactccgcctgcggtgcggtgggcagcctcgccaccgga
gagcgcttgtttgtgtttcgggatccaccggaatccaataactctgttgtggttccagaa
aggaaaaagaagaggaattttctcaatttcaagaaaggctcagttgctcctgcaacctga

KEGG   Xiphophorus couchianus (Monterrey platyfish): 114135906
Entry
114135906         CDS       T05908                                 

Gene name
evc
Definition
(RefSeq) ellis-van Creveld syndrome protein isoform X1
  KO
K19605  ellis van creveld syndrome protein 1
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:xco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    114135906 (evc)
Chromosome and associated proteins [BR:xco03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other cilium assembly proteins
    114135906 (evc)
SSDB
Motif
Pfam: Viral_env_E26
Other DBs
NCBI-GeneID: 114135906
NCBI-ProteinID: XP_027859383
LinkDB
Position
20
AA seq 970 aa
MTTAEVSPECSTDVLVSVAESLHVYPGLLTAAAVCGGLSGILAAALLYVFCMKPLLLTRQ
VYNARRLLEPDVGNIDNNQSDCVSNREKEAASGSANDKEKKRPPMNSDVAAFASRAKVVY
PINQKYRPLADGASNPSLHEQSKLPPMPNEESSSSSDGESLSQEQDNNDSSQFIANMKLP
KSLQNQSFTRVFHYPHTLTHTGFEGRISLYCLALQEVQQHSFQLQEEKYLIFLQMLKVIF
SSRFPKDKNDADFAKDTLMMQEKKLNELRKPLTTGQTTKETIQDAFCSLEEIERAQKDLL
ERILQTSKSFSSQLEDLCQHLLRRKSGFSPEEAHDDILFIVQTLLSVEEHLTMLQEADLK
RTLERLLWWEELSGLVQSQPALLRWEVTLRMGLIATRLEQLTNGESSKLNPAETILSEIQ
AALTEGLHRSTEECTKKTRELVTEKCRKKESKKKKLQKSQMNERSKALEMGLNRCDLQEQ
TSIYQEVLMRHRKEISDLELHQDNKIAEALCSLWKKLRALWSNRLSEIARDIFLASVPTQ
LNLTAEHCESLWLDVEQKLADQLQQAESTARQQLDDIRTELERDQQVWIEGMALGQSCLK
HLGEQQMEIIQAMVARQSYTLSSDIGKLIEKKHKHLSLLMERSFTVRHFSLQMLKEMRLS
KLKVLCQTDFRALLVEEPSKTQPCVDSALKNSRASLAERHLGPESKLLENNLQQEFLSEL
EAATELLQSHAQLALGNALSHAIHHKMEAVPTQSHSSSKHDLGLKHHLTEAAAESVYLTK
DSLRALVHIYYSDLRDISSNLQLDQSNISHEMNKRKDGRSQLSRALLRELVNWGKRPASA
EFQQRVELNKKTLLQQSHLDQERIYEELRKKKVELDQSMDRIKAQLMEAEESFITELAAI
ARVSVHSADQKSSSEEDNSAGEQSAKILDLLTLNPALDPALNPSLTPLFATPVVKSKPKK
KEEKESHLSL
NT seq 2913 nt   +upstreamnt  +downstreamnt
atgacaacggcggaagtgtctccggaatgcagcaccgatgttctggttagtgtcgccgag
tcgctgcatgtgtatccaggactgctgacagcggctgcagtgtgtggcggactgtccggt
atcctggctgcagctctcctctatgtcttctgcatgaagcctctgttgttgaccagacaa
gtttacaacgcgaggaggctgctggaacctgatgttggaaatattgacaataatcagagc
gactgtgtcagcaacagagagaaggaggccgcgagtggctccgccaatgacaaagaaaag
aagcgtcctcctatgaatagtgatgtggctgcatttgcttccagagccaaggtggtttac
ccaatcaaccagaaatacaggcctttagcagacggcgcgtcaaacccgtcccttcatgag
caatcaaagttgccgccgatgcctaatgaggagtcgtcctcatcctccgatggagagtct
ctcagccaggagcaggacaacaatgacagcagtcagttcatcgccaacatgaagctccct
aagagcctgcagaaccagagtttcaccagagtcttccactacccccacacactgacacac
accggctttgaaggcaggatcagcctgtactgtttggctttgcaggaagtacaacagcac
agctttcagcttcaggaagaaaagtatctgatttttctgcagatgcttaaagttatattc
agctctcggtttccaaaagacaaaaacgacgcagactttgccaaggacacacttatgatg
caagaaaagaaactgaatgagttgagaaaaccgctgacgacgggccaaaccaccaaagag
acgatccaggatgctttctgttccctggaggagattgagagagctcagaaagatctcctt
gaacgcatccttcaaacgtctaaaagtttcagctcacaactggaggatttgtgtcagcat
ctgctgaggaggaaaagtggcttctctcctgaggaagcacatgatgacatcctgttcatc
gttcagactctcttgtcagtagaggagcatctgacgatgttacaggaagctgatctgaag
agaacattggagaggttgctgtggtgggaggagttgtcagggctcgttcagtcccagcct
gccttgctgaggtgggaagtgactctgagaatgggtttgatcgccacaagactggagcag
ctaacgaacggtgaaagctcgaagcttaacccagcggaaacgattctctctgagattcag
gccgctctgaccgaaggacttcatcggagcactgaggaatgtacaaagaagacaagggag
ctggtgactgaaaagtgccgcaaaaaggagtccaagaagaagaagcttcagaagagtcag
atgaatgagaggagtaaagctctggagatgggactgaatcgctgtgacctgcaggagcaa
acctctatctaccaggaggtactgatgagacacaggaaggagatttccgatttggagttg
caccaggataacaaaattgcagaggccctctgcagcctttggaagaaacttcgggccctt
tggtcgaacaggctgagtgagatagccagggacatctttctggcctctgttcccactcag
ctgaacctcactgctgagcactgtgagagtctatggctggacgtggagcagaagcttgct
gatcagctgcagcaggcagagagcaccgccaggcagcaactggacgacatcaggaccgag
ctggagagggatcagcaggtgtggattgaagggatggctctggggcagtcttgtctcaaa
catctgggtgaacagcagatggaaatcattcaagctatggtggccagacagagctacact
cttagcagtgacatagggaaactgatagagaagaaacacaagcacctctcgctgctgatg
gagcggtcctttactgtccggcacttcagtctgcagatgctgaaagagatgaggctctcc
aaacttaaggtgctctgtcagactgacttcagagctctgctagtggaagagcccagtaaa
acccaaccctgtgttgattcagctctcaagaacagccgggccagcctcgcggagaggcac
ctgggtccagaaagcaagctactggagaacaacctccaacaggagttcctgtctgagctg
gaagctgccacggagcttcttcagagccatgcacagctggcgctaggcaacgccctcagc
cacgccatccatcacaagatggaggctgtgcccacacagtcacatagttcctctaaacat
gacctgggcctgaaacatcacctgactgaggctgcagcagagagtgtctacttgaccaaa
gattctctcagggcgttggttcacatctattactctgacctacgagacatttctagtaat
ctgcagctggatcagtcaaacataagccacgagatgaataagaggaaagatggcaggagc
cagctgagcagagctttgctgagagaacttgtgaactggggcaagagacccgcttctgca
gagtttcaacaaagggtggaactgaataaaaaaacgctccttcagcaaagtcatctggat
caggagaggatttacgaggagctgaggaagaaaaaagtagagctggaccaaagcatggac
cggattaaagcccagttaatggaggcagaagaaagcttcattactgagctggcagctata
gcccgcgtttctgtccacagtgcagaccagaagtccagcagcgaggaggacaactctgca
ggtgaacagagtgccaagatacttgaccttctgaccctgaacccagcattagatccagcc
ttgaatccttctttgactccactgtttgcaactcctgtggtgaaatcaaagccaaagaag
aaagaagagaaagagtctcatctctctctataa

DBGET integrated database retrieval system