KEGG   Xiphophorus couchianus (Monterrey platyfish): 114135819
Entry
114135819         CDS       T05908                                 

Definition
(RefSeq) caveolin-2-like
  KO
K12958  caveolin 2
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04144  Endocytosis
xco04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:xco00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    114135819
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    114135819
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:xco04131]
    114135819
Membrane trafficking [BR:xco04131]
 Endocytosis
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    114135819
SSDB
Motif
Pfam: Caveolin
Other DBs
NCBI-GeneID: 114135819
NCBI-ProteinID: XP_027859224
LinkDB
Position
20
AA seq 159 aa
MDEDRLKSGELMEVKVDEGPDFTHRNSQSQIEDRDPNRVNSNLKVMFEDVIAEPPSVRSF
DKVWLWSHALFEVSRLWGYRFISLVLAVPVSLTAGLLFAVLSCLHIWLIMPGVQLLLINM
QWIQTVWASILNIFITPFYTSFGKCCGQIIIRLASADNR
NT seq 480 nt   +upstreamnt  +downstreamnt
atggatgaggacagactgaaatcgggggaactgatggaagtaaaggtggatgagggtccg
gatttcacccaccgtaattcacaatcccagattgaggacagggatcccaacagagtcaac
agcaatctaaaggtcatgtttgaggacgtgattgcggagcccccttcagttcggagcttt
gataaagtctggctctggagtcacgccctgtttgaggtgtccagactgtggggctaccgc
ttcatctctctggtgctggcggtgccggtgtcactgactgcagggctgctctttgctgtt
ctcagttgcctccacatctggctgatcatgcccggcgtgcagcttcttctcatcaatatg
cagtggatccagactgtgtgggccagcatactgaacatttttatcacgcctttctatacc
agttttggaaagtgttgtggtcaaattattatccgcctggcgagtgctgataacagatag

KEGG   Xiphophorus couchianus (Monterrey platyfish): 114136035
Entry
114136035         CDS       T05908                                 

Gene name
cav3
Definition
(RefSeq) caveolin-3
  KO
K12959  caveolin 3
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04144  Endocytosis
xco04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:xco00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    114136035 (cav3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    114136035 (cav3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:xco04131]
    114136035 (cav3)
Membrane trafficking [BR:xco04131]
 Endocytosis
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    114136035 (cav3)
SSDB
Motif
Pfam: Caveolin PAP_fibrillin
Other DBs
NCBI-GeneID: 114136035
NCBI-ProteinID: XP_027859593
LinkDB
Position
20
AA seq 152 aa
MADQYQYNTNEEKIVKDSHTKEIDLINRDPKQINEDVVKVEFEDVIAEPDGTHSLDGVWR
LSYTTFTVSKYWCYRVLSAVFGIPVALLWGFLFACISFCHIWAVVPCIKSCLIESQCVSR
IYSLCIQTFCDPFFEALGKIFSSVRVALRKEV
NT seq 459 nt   +upstreamnt  +downstreamnt
atggcggatcagtaccagtacaacaccaacgaggagaagattgtgaaggacagccacacc
aaggagatcgatctgattaacagagaccccaaacaaatcaatgaggacgtggtgaaggtg
gagtttgaggatgtaatcgcagagcctgatggcacacacagcctggatggagtgtggagg
ctcagctacactactttcactgtgtccaaatactggtgctaccgcgtcctgtctgctgtc
tttggcatcccagtcgctctgctctggggcttcctgtttgcctgcatctccttctgccac
atctgggccgtggttccctgcatcaagagctgtctgattgagtcgcagtgcgtcagccgc
atttactcactctgcattcagaccttctgtgatcctttctttgaagctctgggcaaaatt
ttcagcagcgtccgcgtggcactgcgcaaagaagtctaa

KEGG   Xiphophorus couchianus (Monterrey platyfish): 114136168
Entry
114136168         CDS       T05908                                 

Definition
(RefSeq) caveolin-2-like
  KO
K12958  caveolin 2
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04144  Endocytosis
xco04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:xco00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    114136168
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    114136168
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:xco04131]
    114136168
Membrane trafficking [BR:xco04131]
 Endocytosis
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    114136168
SSDB
Motif
Pfam: Caveolin
Other DBs
NCBI-GeneID: 114136168
NCBI-ProteinID: XP_027859795
LinkDB
Position
20
AA seq 188 aa
MDTLKKDEDSEEVEIDLEDSSDPEESEDGEEPQTLWRAQPSLDEEENIHTSTLVEISDTK
PLITSRDARGVNNCLKVGFEDVIAEPPSVRSGDRVWIWSNALFEVSRVWIYRIVTAFLAL
PMSAISGLLFGLLSCFHIWMIRPCIHCVLIGNRWIQGFWDIMLQVVVVPFLTSAGKCCGS
LGIHLAKE
NT seq 567 nt   +upstreamnt  +downstreamnt
atggataccctgaagaaagacgaagattctgaggaagtggaaattgatcttgaggattcc
agtgaccctgaagagtctgaagatggggaggaaccgcagacgttatggagagcccaaccc
tctctggatgaggaggaaaacattcatacatccactctggtggaaatcagtgatacaaaa
ccactgataacttcaagggatgcccgaggtgtcaataactgcctcaaggtagggtttgag
gatgtgatagctgagccgccatcagtgcgtagcggggacagagtttggatctggagcaat
gctctctttgaagtgtccagggtctggatttacaggatagtcaccgcttttctggccctt
cccatgtcagctatctctggtcttttgtttggcctcctcagctgcttccacatttggatg
attcgtccctgtattcattgtgtcctcatcggtaatcgctggatacagggcttctgggac
attatgctgcaagttgttgtggtcccattcctaacaagtgcaggaaaatgttgcggaagt
ttaggtatacacctggccaaagaatga

KEGG   Xiphophorus couchianus (Monterrey platyfish): 114142844
Entry
114142844         CDS       T05908                                 

Gene name
cav1
Definition
(RefSeq) caveolin-1
  KO
K06278  caveolin 1
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04144  Endocytosis
xco04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:xco00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    114142844 (cav1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    114142844 (cav1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:xco04131]
    114142844 (cav1)
Membrane trafficking [BR:xco04131]
 Endocytosis
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    114142844 (cav1)
SSDB
Motif
Pfam: Caveolin
Other DBs
NCBI-GeneID: 114142844
NCBI-ProteinID: XP_027870153
LinkDB
Position
4
AA seq 180 aa
MTGELRDDETEEEYLHSFIRKQGNIYKPNNKDMENESLNEKAMEDVHTKEIDLVNRDPKR
INDDVVKVDFEDIIAEPAGTYSFDGVWKASFTTFTVTKYWCYRLLTALVGIPLALIWGIF
FAILSFVHIWAVVPCVKSYLIETHCISRVYSIFVHTFCDPLFEAMGKCFSNIRLRTTKEV
NT seq 543 nt   +upstreamnt  +downstreamnt
atgacaggagagctgcgggacgacgaaacggaggaggagtatctgcattcgttcatccgg
aaacaagggaacatttacaaaccgaacaacaaagacatggaaaacgagagtctgaacgag
aaggcgatggaggacgtccacaccaaggagatcgacctggtcaacagggatccgaagcgc
atcaacgacgacgtggtcaaggtggacttcgaggacatcatcgcagagcctgcgggaaca
tacagctttgacggcgtgtggaaagctagcttcaccaccttcaccgtcaccaagtactgg
tgctaccggctgctgacggcgctggtcggcattcccctggcactgatctggggaatcttc
ttcgccatcctttcctttgtccacatctgggccgtggtgccgtgcgtgaagagttacctt
atcgagacccactgcatcagccgcgtctattccatcttcgtccacaccttctgcgacccg
ctgttcgaggccatgggcaagtgcttcagcaacatccggctccgcacgacaaaggaggtg
taa

KEGG   Xiphophorus couchianus (Monterrey platyfish): 114143439
Entry
114143439         CDS       T05908                                 

Gene name
cav2
Definition
(RefSeq) caveolin-2 isoform X1
  KO
K12958  caveolin 2
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04144  Endocytosis
xco04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:xco00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    114143439 (cav2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    114143439 (cav2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:xco04131]
    114143439 (cav2)
Membrane trafficking [BR:xco04131]
 Endocytosis
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    114143439 (cav2)
SSDB
Motif
Pfam: Caveolin Voltage_CLC
Other DBs
NCBI-GeneID: 114143439
NCBI-ProteinID: XP_027871285
LinkDB
Position
4
AA seq 163 aa
MGVEKEKLDTSIIMDKDEYNLSIEPILMKKGKVYSEAPDRDPNDINTHLKQVGFEDVIGE
PSSAHSFDRVWIGSHATFELVKFFFYRLLTTLLAIPMAFTLGLLFGVLSCVHVWLVMPVV
QSFMMLLPSAQKIWRSLTDIFIAPLFQSLGKCLSSIQIQTPEN
NT seq 492 nt   +upstreamnt  +downstreamnt
atgggtgtggagaaggaaaagctggacaccagcataattatggacaaggacgagtacaac
ctgtccatagagcccattctgatgaagaaagggaaggtgtactcggaggcgccggatcgg
gatccaaacgacatcaacacgcatctgaagcaggtgggttttgaggacgtgatcggcgag
ccgagctccgcccacagcttcgacagagtttggatcgggagccacgccaccttcgagctc
gtcaagttcttcttctaccggctgctgaccaccctactggcaattcccatggccttcaca
ctggggctgctcttcggagtgctgagctgcgtccatgtctggctggtgatgccagtggtc
cagagcttcatgatgctcctgccttcagcgcagaagatatggaggagtctgacggacatt
ttcatagctccactgttccagagtctggggaaatgtttgtcctccattcagattcaaacc
ccagagaactga

KEGG   Xiphophorus couchianus (Monterrey platyfish): 114148419
Entry
114148419         CDS       T05908                                 

Definition
(RefSeq) caveolin-2-like
  KO
K12958  caveolin 2
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04144  Endocytosis
xco04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:xco00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    114148419
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    114148419
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:xco04131]
    114148419
Membrane trafficking [BR:xco04131]
 Endocytosis
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    114148419
SSDB
Motif
Pfam: Caveolin
Other DBs
NCBI-GeneID: 114148419
NCBI-ProteinID: XP_027879558
LinkDB
Position
1
AA seq 193 aa
MMMVSDDCLVECKIDDSDEEQVNTPPPPPEFASKASTPAPKDPTPPANSPSPAPTRPVNR
DPHGINQHLKVEVRDVLAELATPHSIDGVWTYSLVGFEKTRIWTYRCLSLLFAVPLAFLC
GLFLAVLACLRVWFLVPCIQLSNTFLPCLRSLVICAVNVFISPFCMSLALCCTQISISLS
NKDLDRKRDKDTV
NT seq 582 nt   +upstreamnt  +downstreamnt
atgatgatggtgagcgatgactgtctggtggagtgtaagattgatgacagtgatgaggaa
caggtgaacactcctccccctcccccagaatttgcatcgaaagcttcaactccagctcca
aaagacccaacccctcccgcgaattctccgagtcccgctccgacccgacctgtcaacaga
gacccacatggcatcaaccaacaccttaaggtggaggtcagagatgttctggctgaactt
gccactcctcatagcatagatggtgtatggacctacagtctggttggctttgagaagact
cgcatctggacctatcgctgcctctccttgctgtttgctgtgcctcttgcgttcctgtgt
ggactcttcctagccgtcctcgcctgcctacgcgtctggttcctggttccctgcatacag
ctgagcaacaccttcctgccctgcttgcgctccttggttatatgtgctgtgaatgtcttc
atctcccctttctgtatgtctctggcactctgctgcactcagatctccatctcactgtcc
aacaaagacttggatcgaaagagagataaagacactgtgtga

DBGET integrated database retrieval system