KEGG   Xiphophorus couchianus (Monterrey platyfish): 114136223
Entry
114136223         CDS       T05908                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1-like isoform X1
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04012  ErbB signaling pathway
xco04068  FoxO signaling pathway
xco04110  Cell cycle
xco04115  p53 signaling pathway
xco04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:xco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    114136223
   04068 FoxO signaling pathway
    114136223
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    114136223
   04115 p53 signaling pathway
    114136223
   04218 Cellular senescence
    114136223
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 114136223
NCBI-ProteinID: XP_027859879
LinkDB
Position
20
AA seq 207 aa
MSTRLCPGMYRAGERRAGESLTAASLFKSSAAVRLLLHTGGVKHGRKMCRIMAPHKPTLS
SLGGNRRVRRNLFGPVDRDQLQAEYQAALRKDLDEASKRWGFDFKSYKPLESSDFKWEGI
PETRVPLLYRSCVPAEGLGLAGGAVPTKPARVEKENIPQTPGKWKLQDLKKTPEKGDKAA
LKRKQTNITDFYQAKRRVVWKPRKSGE
NT seq 624 nt   +upstreamnt  +downstreamnt
atgtccaccagattatgtccaggcatgtaccgagctggagagaggagggctggtgagtca
ctgacggctgccagcctgtttaaaagcagcgctgcagtcaggctgcttcttcacacagga
ggtgttaaacacggcaggaagatgtgcagaatcatggctcctcacaagccgacgctgagc
tccttaggggggaacaggcgggtccgcaggaacctgttcggccctgtggaccgagaccag
ctgcaggcggagtaccaggcagcgctgcgcaaggacctggacgaagcgtccaaacgatgg
ggctttgacttcaagtcgtacaagcctctggagagcagcgacttcaagtgggagggcatc
ccagaaaccagggtgccactgctctaccggtcctgcgtgccggcggagggcctggggctg
gcaggaggggctgttccgaccaaaccagcaagggtggagaaggagaacatccctcagacg
ccagggaagtggaaactgcaggacctgaagaaaacgccagagaagggagacaaagctgcg
ctgaagaggaaacagacgaatattacagatttctatcaggccaagagacgagttgtgtgg
aagccgaggaaatccggggagtga

DBGET integrated database retrieval system