KEGG   Xiphophorus couchianus (Monterrey platyfish): 114136393
Entry
114136393         CDS       T05908                                 

Gene name
shh
Definition
(RefSeq) sonic hedgehog protein
  KO
K11988  sonic hedgehog
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:xco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    114136393 (shh)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:xco01002]
    114136393 (shh)
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:xco00536]
    114136393 (shh)
Peptidases and inhibitors [BR:xco01002]
 Cysteine peptidases
  Family C46: hedgehog family
   114136393 (shh)
Glycosaminoglycan binding proteins [BR:xco00536]
 Heparan sulfate / Heparin
  Morphogens
   114136393 (shh)
SSDB
Motif
Pfam: HH_signal Hint Hint_2 Peptidase_M15_3 Intein_splicing Vint Hom_end_hint DUF2092
Other DBs
NCBI-GeneID: 114136393
NCBI-ProteinID: XP_027860058
LinkDB
Position
21
AA seq 411 aa
MHQRWTRIASVALICLSLVSSAMGCGPGRGYGRRRHPKKLTPLAYKQFIPNVAEKTLGAS
GRYEGKITRNSERFKELTPNYNTDIIFKDEENTGADRMMTQRCKDKLNSLAISVMNQWPG
VKLRVTEGWDEDGHHFDESLHYEGRAVDITTSDRDKSKYGTLSRLAVEAGFDWVYYESKA
HIHCSVKAENSVAAKSGGCFPGSSTVTLQDGTKKPVRDLQPGDRVLAADGVGNPIFTDFI
MFIDRDSTTRRTFYVIETETGQKITLTAAHLIFVARENSTRSATFASDVRPGQKVFVYDG
ERRRVVAVNVKRIYTQEHEGSFAPVTAQGTVVVDQVLASCYAVIEDHQLAHWALAPVRIA
HWVSSSLFISRPRVSAHNEGVHWYSKLLYQLGTWLLDDHSIHPLGMSAYPS
NT seq 1236 nt   +upstreamnt  +downstreamnt
atgcatcagcgctggaccagaatcgcttctgtcgctctcatctgcttgtccttggtgtcc
tccgcgatgggatgcggaccgggcaggggctacggcaggaggagacaccccaagaagctg
acacctctggcgtacaagcagttcatccccaatgtggcggagaagaccctgggggcgagc
ggtagatacgagggcaagatcacacggaactccgagcgctttaaagagctcactcccaat
tataacacagacatcatcttcaaggatgaggagaacacaggagccgacaggatgatgact
cagagatgcaaggacaagctgaattcgctggccatctctgtgatgaaccaatggcccggg
gtgaaactccgggtcacagagggctgggacgaggacgggcaccactttgacgagtccctg
cactatgagggcagggccgtggacatcaccacctcagacagagacaagagcaaatatggc
accttgtccaggctcgccgtggaagccggattcgactgggtctactatgagtcaaaggcc
cacatccactgctctgtgaaagcagaaaattcagtggcagcaaagtcaggtggctgcttc
ccgggatcctccacagtcaccctgcaggacggcaccaagaagccggtcagagacctccaa
cccggggacagagtcctggctgcggacggcgtcggaaacccgatcttcaccgacttcatc
atgttcatagaccgagactccaccaccaggaggaccttctacgtgatcgagaccgagacg
ggccagaagatcaccctcaccgccgcgcacctcatctttgtcgcccgcgagaactccacg
cggtcggcaacgttcgccagcgacgtgcgacccggacagaaggtgttcgtctacgacggg
gagcggaggcgagtcgtggccgtgaacgtgaaacggatttacacgcaagagcacgagggc
tccttcgcgcccgtgacggcacaggggaccgtggtggtggatcaggttctggcatcctgt
tacgcagtgatcgaggaccaccagcttgcgcactgggccctggcgcccgttaggatcgcc
cactgggtgtcctcctcgctgttcatctcccggcctcgggtcagcgcgcacaacgagggg
gtccactggtactccaaacttctttaccagctggggacgtggctcttggacgaccactcg
atccatccactgggaatgtcagcatacccaagctga

KEGG   Xiphophorus couchianus (Monterrey platyfish): 114142553
Entry
114142553         CDS       T05908                                 

Gene name
dhh
Definition
(RefSeq) desert hedgehog protein
  KO
K11990  desert hedgehog
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:xco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    114142553 (dhh)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:xco01002]
    114142553 (dhh)
Peptidases and inhibitors [BR:xco01002]
 Cysteine peptidases
  Family C46: hedgehog family
   114142553 (dhh)
SSDB
Motif
Pfam: HH_signal Hint Vint Peptidase_M15_3
Other DBs
NCBI-GeneID: 114142553
NCBI-ProteinID: XP_027869724
LinkDB
Position
1
AA seq 446 aa
MKQFWWARLAPLGLLAACTCLGVVQGCGPGPGYGTRSRPRKLTPMRYKQFFPNFSENTLG
ASGRAEGKISRNSERFNQLVCNYNPDIVFKDEENTSADRVMTKRCKDCLNRLAIAVMNQW
PGVHLRVTEAWDEDGHHPQGSLHYEGRAVDITTDDRETKKYGILAQLAVEAGFDWVHYES
RYHIHCSVKADKSEAVERGGCFPGWARVTVAGGRQKTLSSLASGDRILALSGTGQVVYSE
VLLFLHRDQESRSVFLSLEADGGNRLVVTPHHLVFLDPDCGRDANEYQAEFASRARVGDC
VLIGTPGGQTETSRIISVSLTESVGVFAPLTEAGTLFVDGVLVSSYALLEDHDLAHWAFG
PLRLLHSLNHFFGGEDVKGKQKAGTKSATQFGTTEKVSIHKQNNLSEPLRMKDQEQCSLK
TSEIHWYARLLYRFASIFLDSNIFHA
NT seq 1341 nt   +upstreamnt  +downstreamnt
atgaagcagttctggtgggcccgcctggcaccgctcggcctgcttgctgcttgtacctgc
ctaggcgtggtccagggatgcggacccggtcctgggtacggcacgcgttccaggcccagg
aagctcacacctatgcgctacaagcagttcttccccaacttctctgagaacacccttggg
gccagtggcagggccgagggcaagatctcacgcaactctgagcgcttcaatcagctagtg
tgcaactacaacccagacattgtcttcaaagacgaggagaacacaagcgccgatcgggtc
atgactaagcgatgtaaggactgtttgaacaggttggccattgctgtgatgaaccagtgg
ccaggggtgcacctccgcgtgacggaggcctgggatgaagacggccaccaccctcagggc
tctctgcactacgaaggccgggccgtggatataaccacagacgacagagaaacaaagaag
tacggcatcctggcccagctggctgtagaagcaggatttgactgggtccattatgagtcc
agatatcacatccactgttcagtcaaagcagataaatctgaagcagtggagaggggtggg
tgtttcccaggctgggcccgggtgacggttgctggaggaaggcagaagactctgtcatca
ctggcctctggcgaccggatcctggctctgtctgggacaggccaggtcgtgtacagcgaa
gtcctcttgtttctgcaccgggaccaggaaagccggtctgtctttctgtctctggaggca
gatggtggcaaccgactggtcgtgactccacatcatttagtgtttttagaccccgactgt
ggacgcgatgctaatgagtatcaggctgagttcgcgagcagagccagagtcggtgactgc
gtcctcatcggcacaccggggggtcaaacagaaacatcccgaatcatatctgtctctctt
actgaaagtgtgggagtgtttgcgcccctcactgaagctggaactttgtttgttgacggg
gtgcttgtgtccagctacgcactgctggaggaccacgaccttgcacactgggcatttgga
cctttacggcttctccattcactgaaccacttttttgggggggaagacgtaaaagggaag
caaaaagctggcactaagagtgcaacacagtttggcacaacagaaaaagtgagtattcac
aaacaaaacaatctcagtgaacctcttcgaatgaaagatcaagagcagtgctccttgaag
acatcagaaatacactggtatgctagattactctacagatttgcaagcatcttcttggac
tccaacattttccatgcttaa

KEGG   Xiphophorus couchianus (Monterrey platyfish): 114148134
Entry
114148134         CDS       T05908                                 

Definition
(RefSeq) indian hedgehog B protein-like
  KO
K11989  indian hedgehog
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:xco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    114148134
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:xco01002]
    114148134
Peptidases and inhibitors [BR:xco01002]
 Cysteine peptidases
  Family C46: hedgehog family
   114148134
SSDB
Motif
Pfam: HH_signal Hint Peptidase_M15_3
Other DBs
NCBI-GeneID: 114148134
NCBI-ProteinID: XP_027878941
LinkDB
Position
7
AA seq 434 aa
MRISFLLLAASLCASVLLLAPASEGCGPGRGYGKRRLPKKLIPLAYKQFSPNVAEKTLGA
SGRPEGKITRNSERFKELTPNYNTDIIFKDEEDTGADRLMTQRCKDKLNSLAISVMNMWP
GVKLRVTEGWDEDGHHSIDSLHYEGRAVDITTSDKDKNKYAMLARLAVEAGFDWVYYESK
AHIHCSVKSEHSVAAKTGGCFPGDAQVTIEGGRIKQMRDLLPGDRVLASSSTDVHAPLLY
SPVVSFLDRQPNATRTSYVIGTDGGHNITLTAAHLIFVTECSSRLTRSGQEETSQDTKLF
GSTWQRRGHEPGMRTVFASEVQPGQCVFTSSGRSKSHPRLSVVTFVEEQTSTGLYAPLTQ
HGSIVVNSVLASCYAAVDSHYLSHWVLAPLRLIYRITGHSQVQNDGLHWYPWILQRLGKV
LLGTEHFHPYGFDQ
NT seq 1305 nt   +upstreamnt  +downstreamnt
atgcggatctccttcctccttctcgcagcctctctgtgcgcctctgtcctcctcctcgca
cctgcttcggagggctgcgggccggggaggggatacggcaagaggcggctccccaagaag
ctcatcccgctcgcctacaagcagttcagcccaaacgtggccgaaaagaccctgggagcg
agcgggcgacccgaggggaaaattacgcgcaactctgagcgcttcaaggagctcacgccg
aactataatacagacataatctttaaagatgaggaggacacgggcgcagacaggcttatg
actcagcgttgtaaagacaagctgaactctttggccatctctgtgatgaacatgtggcca
ggtgtgaagctgagagtaacagagggctgggatgaggatggtcatcactcaatcgactca
ctgcactatgaggggcgtgctgtcgacatcaccacctcagacaaggacaaaaataagtat
gccatgttggcccgcctggcagtagaggctggatttgactgggtctactatgagtctaaa
gcccacattcactgtagcgtgaagtcagagcactcagtggcagccaaaaccggaggatgt
ttccctggcgacgctcaggtcaccattgaaggtggacgcatcaaacagatgcgtgacctc
ctccctggcgaccgtgtccttgcgtcctcctcaacagatgtccacgctccactcctctac
agccccgttgtgtcttttctggatcgccagcccaatgccacgaggacctcctatgttatt
gggacggatgggggacataacatcaccctcacagccgctcacctgatctttgtcacagaa
tgttccagcagactgaccaggtcagggcaggaagagacatctcaggacacaaagcttttt
ggttccacttggcagagaaggggacatgaaccaggtatgaggacagtttttgccagtgaa
gtccagcctggacagtgtgtctttacatcttctggcagatcaaagtcacatccaagactc
tcagttgtgacgtttgttgaggagcagacaagcactgggttatatgccccgctcacccag
catgggtctatagtggtgaacagcgtgttagcatcttgctacgctgccgtggacagtcac
tatttgtcccactgggtcttggctcctttgagacttatttacagaataacaggacactct
caagttcagaatgatgggctgcactggtacccgtggattctgcaaaggctggggaaagtg
ctgctgggcactgaacacttccacccttatggctttgaccagtga

DBGET integrated database retrieval system