KEGG   Xiphophorus couchianus (Monterrey platyfish): 114136829
Entry
114136829         CDS       T05908                                 

Gene name
spop
Definition
(RefSeq) speckle-type POZ protein
  KO
K10523  speckle-type POZ protein
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:xco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    114136829 (spop)
Ubiquitin system [BR:xco04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     114136829 (spop)
SSDB
Motif
Pfam: BTB MATH BACK
Other DBs
NCBI-GeneID: 114136829
NCBI-ProteinID: XP_027860942
LinkDB
Position
2
AA seq 374 aa
MSRVPSPPPPAEMSSGPVAESWCYTQIKVVKFSYMWTINNFSFCREEMGEVIKSSTFSSG
ANDKLKWCLRVNPKGLDEESKDYLSLYLLLVSCPKAEVRAKFKFSILNAKGEETKAMESQ
RAYRFVQGKDWGFKKFIRRDFLLDEANGLLPDDKLTLFCEVSVVQDSVNISGQNTMNMVK
VPDCRLADELGGLWENSRFTDCSLCVAGQEFQAHKAILAARSPVFSAMFEHEMEESKKNR
VEINDVEPEVFKEMMCFIYTDKAPNLDKMADDLLAAADKYALERLKVMCEDALCTSLSVE
NAAEILILADLHSADQLKTQAVDFINYHAAEVMETAGWKSMVASHPHLVAEAYRSLASAQ
CPFLGPPRKRLKQS
NT seq 1125 nt   +upstreamnt  +downstreamnt
atgtccagggtcccgagtccgccgccccctgcggaaatgtccagcgggcccgtggccgag
agctggtgctacacgcagatcaaagtggtgaagttttcctacatgtggaccatcaacaac
ttcagcttctgtcgtgaggaaatgggcgaagtcatcaagagttcgaccttctcttctggg
gccaacgacaaactcaaatggtgtttgcgagtgaatcccaaaggcctggatgaggaaagc
aaagattacctgtctctgtacctgctgctggtcagctgtccaaaagcagaggtgcgagca
aagttcaagttctccatcctcaacgccaagggagaggagaccaaagcaatggaaagccag
agggcgtaccgcttcgtccagggaaaagactggggctttaagaagttcatccggagagac
ttcctcctggacgaggctaacggtctcctacctgacgataagctaacgctgttctgcgag
gtgagcgttgtgcaggactcggtcaacatatcgggtcagaacacgatgaacatggtgaag
gtaccggactgccggctagcggacgagctgggtggcttgtgggagaactcgcgcttcaca
gactgctccctgtgtgtggctggacaggagtttcaggcccacaaagccatcctggcagcg
cgttcccctgtattcagcgccatgtttgagcacgagatggaggagagcaaaaagaatcgt
gtggagatcaacgacgtggagccagaagttttcaaggagatgatgtgcttcatttacaca
gacaaagctcccaacctggacaagatggccgacgacctgctagcagcagccgataagtac
gctctggagagactcaaggtcatgtgcgaagacgcgctgtgcaccagcctgtccgtggag
aacgccgccgagatcctcatcctggccgacctgcacagcgccgaccagctcaaaacgcag
gcggtcgacttcatcaactaccacgcagcggaggtgatggaaaccgccggctggaagtcg
atggtcgcctcccatccgcacctggtggctgaagcttaccgctcgctggcgtccgcccag
tgccccttcctcggaccgccccgcaagcgcctcaaacaatcctaa

KEGG   Xiphophorus couchianus (Monterrey platyfish): 114148871
Entry
114148871         CDS       T05908                                 

Gene name
spopl
Definition
(RefSeq) speckle-type POZ protein-like
  KO
K10523  speckle-type POZ protein
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:xco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    114148871 (spopl)
Ubiquitin system [BR:xco04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     114148871 (spopl)
SSDB
Motif
Pfam: BTB MATH BTB_2
Other DBs
NCBI-GeneID: 114148871
NCBI-ProteinID: XP_027880163
LinkDB
Position
7
AA seq 392 aa
MSRVPTPPPPGEMSSGPVAESWCYTQVKVVKFSYMWTINNFSFCREEMGEVLKSSTFSSG
PNDKMKWCLRVNPKGLDDESKDYLSLYLLLVSCPKSEVRAKFKFSLLNAKREETKAMESQ
RAYRFVQGKDWGFKKFIRRDFLLDEANGLLPDDKLTLFCEVSVVQDSVNISGQSNMNMLK
VPECQLSDDLGNLWECSRFTDCSLYVGGQEFKAHKSILAARSPVFNAMFEHEMEESKKNR
VDISDVDPDVFREMMGFIYTGKAPNLEKMADNLLAAADKYALERLKVMCEEALCNSLSVE
NVADTLILADLHSAEQLKAQAIDFINRCSVLRQLGCKDGKNWNSNHATDIMETAGWKSMI
QSHPHLVAEAFRALASAQCPPFGLPRKRLKQS
NT seq 1179 nt   +upstreamnt  +downstreamnt
atgtcacgggttcccacccctcctcctcctggggagatgtcaagtggacctgtggcagag
agctggtgttacacacaggtcaaagtagtgaagttttcctacatgtggaccataaacaac
tttagtttttgcagagaagaaatgggagaggtgttgaagagttcaaccttctcttctggc
cctaatgacaaaatgaaatggtgtctgagagttaatccaaagggacttgatgatgaaagc
aaagattatctatcactgtatttacttcttgttagttgtccaaaaagtgaagtcagagca
aagtttaagttttctttgttgaatgctaaaagagaggaaacaaaagcaatggagagccaa
agagcgtataggtttgtccaaggcaaagactggggcttcaaaaaatttataaggagagat
ttcctccttgatgaagctaatggtctcttacctgatgacaagctcacacttttttgtgag
gtaagtgtcgtccaggactctgtcaacatttcgggtcagtctaacatgaacatgctgaaa
gtaccagaatgtcagctgtctgatgaccttgggaacctgtgggagtgttcacgcttcaca
gactgcagcctctatgtgggaggccaagagttcaaagcccacaaatccatccttgcagcg
aggtctccagtctttaatgcaatgtttgaacatgaaatggaagaaagtaaaaagaatcga
gttgacatcagtgatgtggatccagatgtctttagggaaatgatgggcttcatttataca
gggaaggcgccaaacttggaaaaaatggcagacaatttgctggcagctgctgataaatat
gctctggagcgtttaaaggtcatgtgtgaggaggccttgtgcaacagcctttcagtggag
aatgtggccgacaccctcatcttggctgacttgcacagtgccgagcaactcaaagcacaa
gccatagattttatcaacaggtgcagtgtcctgagacagctgggctgtaaagatggaaag
aactggaatagcaatcacgccacagacataatggagaccgcaggctggaagtcaatgatc
cagtcccatcctcacttggtagctgaagccttccgtgccctggcttctgcacagtgccca
ccctttggtcttccgaggaagcgcctaaaacagtcctga

DBGET integrated database retrieval system