KEGG   Xiphophorus couchianus (Monterrey platyfish): 114137669
Entry
114137669         CDS       T05908                                 

Definition
(RefSeq) mitogen-activated protein kinase 8-like isoform X1
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04010  MAPK signaling pathway
xco04012  ErbB signaling pathway
xco04068  FoxO signaling pathway
xco04137  Mitophagy - animal
xco04140  Autophagy - animal
xco04141  Protein processing in endoplasmic reticulum
xco04210  Apoptosis
xco04217  Necroptosis
xco04310  Wnt signaling pathway
xco04510  Focal adhesion
xco04530  Tight junction
xco04620  Toll-like receptor signaling pathway
xco04621  NOD-like receptor signaling pathway
xco04622  RIG-I-like receptor signaling pathway
xco04625  C-type lectin receptor signaling pathway
xco04910  Insulin signaling pathway
xco04912  GnRH signaling pathway
xco04914  Progesterone-mediated oocyte maturation
xco04920  Adipocytokine signaling pathway
xco05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:xco00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    114137669
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    114137669
   04012 ErbB signaling pathway
    114137669
   04310 Wnt signaling pathway
    114137669
   04068 FoxO signaling pathway
    114137669
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    114137669
   04137 Mitophagy - animal
    114137669
  09143 Cell growth and death
   04210 Apoptosis
    114137669
   04217 Necroptosis
    114137669
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    114137669
   04530 Tight junction
    114137669
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    114137669
   04621 NOD-like receptor signaling pathway
    114137669
   04622 RIG-I-like receptor signaling pathway
    114137669
   04625 C-type lectin receptor signaling pathway
    114137669
  09152 Endocrine system
   04910 Insulin signaling pathway
    114137669
   04920 Adipocytokine signaling pathway
    114137669
   04912 GnRH signaling pathway
    114137669
   04914 Progesterone-mediated oocyte maturation
    114137669
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    114137669
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:xco01001]
    114137669
Enzymes [BR:xco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     114137669
Protein kinases [BR:xco01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   114137669
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo RIO1 APH Kinase-like
Other DBs
NCBI-GeneID: 114137669
NCBI-ProteinID: XP_027862229
LinkDB
Position
22
AA seq 487 aa
MRCYADAWEGRSIPLLQGSSPTMIITLRALFEQGRTFLDAQKAVIEDFAMNKNKRDREFY
SVDVGDSTFTVLKRYQNLRPIGSGAQGIVCSAYDQILERNVAIKKLSRPFQNQTHAKRAY
RELVLMKCVNHKNIIGLLNVFTPQKSLEDFQDVYLVMELMDANLCQVIQMELDHERLSYL
LYQMLCGIKHLHGAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAATGLLMTPYVVTRYY
RAPEVILGMGYQANVDIWSVGCILAEMVRHKILFPGRDYIDQWNKVIEQLGTPSQDFLMK
LNHSVRTYVENRPRYAGYSFEKLFPDVLFPADSDHNKLKASQARDLLSKMLVIDASKRIS
VEEALHHPYINVWYDPAEVEAPPPKIPDRTLDEREHTVEEWKELIYKEVIEWEERTKNGV
IRGQPTALGAAVIDSPPQPTSSSSSSANDVSSMSTEPTDPGSDPALGSETDSSLDSHTSL
SALACCR
NT seq 1464 nt   +upstreamnt  +downstreamnt
atgcgctgctacgctgacgcctgggaaggacgaagcatcccgctgctgcagggcagctcc
ccgacgatgatcataacactgcgggctctcttcgaacaagggaggacatttttggatgca
cagaaagcagtaatcgaagactttgccatgaacaaaaacaagagagacagagagttctac
agtgtagacgttggggattcaacatttacagtactgaagcgataccagaatctaagaccc
atcggctcaggagcacagggaatcgtctgctctgcttatgaccaaatccttgaacgaaat
gttgccatcaagaagctgagtcgaccctttcaaaatcaaacccatgctaagagggcgtac
agagagctagtcctaatgaaatgtgtcaatcacaaaaatatcattggcctattaaatgta
ttcacgccacaaaaatcgctagaagatttccaagatgtatacttggtaatggagctgatg
gatgccaacctgtgtcaagtgattcaaatggagctggaccatgagaggttgtcgtacctg
ctctatcagatgttgtgtggcatcaaacacctccacggtgccgggatcatacacagggat
ctgaagcccagtaatatagttgtcaagtctgattgcacgctgaagattttggattttggc
ttggctcggacagcagccacaggccttctgatgacgccatatgtggttacacgctactac
agagcaccagaagtaatcctgggcatgggctaccaggccaacgtggacatatggtctgtg
ggctgcattctggcagaaatggttcgccataaaatccttttccctggaagggactatatc
gaccagtggaataaggtgattgagcagctgggcactccatctcaggattttctaatgaaa
ctgaatcactcagtgagaacgtatgtggaaaacagaccacggtacgccggatacagtttt
gagaagctcttcccagatgtgctcttccctgctgactctgatcacaacaaactgaaagca
agccaagccagagacctgttatccaagatgcttgtgattgatgcgtcaaagcgcatctct
gtggaagaagccttgcaccacccatatattaatgtttggtacgatcctgctgaagtggaa
gcgccgcccccaaagatcccagacaggacactggatgaaagagagcacactgtggaggag
tggaaagagctaatttataaggaagtgatcgaatgggaggaacgaacaaaaaatggagtg
atcagaggtcaacccactgctttaggtgcagcagtgatcgacagtcctcctcagcccaca
tcttcctcctcctcctcggccaacgatgtctcctccatgtctacagagccgaccgatccc
ggcagtgaccccgctttgggctcggagacagacagcagcttggacagccacacctccctc
agtgcgctggcctgctgcagataa

KEGG   Xiphophorus couchianus (Monterrey platyfish): 114139131
Entry
114139131         CDS       T05908                                 

Definition
(RefSeq) mitogen-activated protein kinase 9-like isoform X1
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04010  MAPK signaling pathway
xco04012  ErbB signaling pathway
xco04068  FoxO signaling pathway
xco04137  Mitophagy - animal
xco04140  Autophagy - animal
xco04141  Protein processing in endoplasmic reticulum
xco04210  Apoptosis
xco04217  Necroptosis
xco04310  Wnt signaling pathway
xco04510  Focal adhesion
xco04530  Tight junction
xco04620  Toll-like receptor signaling pathway
xco04621  NOD-like receptor signaling pathway
xco04622  RIG-I-like receptor signaling pathway
xco04625  C-type lectin receptor signaling pathway
xco04910  Insulin signaling pathway
xco04912  GnRH signaling pathway
xco04914  Progesterone-mediated oocyte maturation
xco04920  Adipocytokine signaling pathway
xco05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:xco00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    114139131
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    114139131
   04012 ErbB signaling pathway
    114139131
   04310 Wnt signaling pathway
    114139131
   04068 FoxO signaling pathway
    114139131
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    114139131
   04137 Mitophagy - animal
    114139131
  09143 Cell growth and death
   04210 Apoptosis
    114139131
   04217 Necroptosis
    114139131
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    114139131
   04530 Tight junction
    114139131
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    114139131
   04621 NOD-like receptor signaling pathway
    114139131
   04622 RIG-I-like receptor signaling pathway
    114139131
   04625 C-type lectin receptor signaling pathway
    114139131
  09152 Endocrine system
   04910 Insulin signaling pathway
    114139131
   04920 Adipocytokine signaling pathway
    114139131
   04912 GnRH signaling pathway
    114139131
   04914 Progesterone-mediated oocyte maturation
    114139131
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    114139131
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:xco01001]
    114139131
Enzymes [BR:xco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     114139131
Protein kinases [BR:xco01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   114139131
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo APH RIO1 Kinase-like
Other DBs
NCBI-GeneID: 114139131
NCBI-ProteinID: XP_027864619
LinkDB
Position
23
AA seq 420 aa
MSEAEGQFYSVQVGDSTFTVLKRYQQLRAIGSGAQGIVCSALDTVLGIPVAVKKLCRPFQ
NQTHAKRAYRELVLLKCVNHKNIIRLINVFTPQKSLEEFQDLYLVMELMDASLCQVIHMD
LDHERMSYLLYQILCGIRHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTACTNFMM
TPYVVTRYYRAPEVILGMKYKENVDIWSVGCIMGEMVKGSVIFQGTDHIDQWNKVIEILG
TPSLEFMNRLMETVRNYVMNKPQYPGISFTELFPDFAFPSESEQDKVKTVQARDLLSKML
VIDPECRISVEEALHHPYIHVWYDPAEADAPPPQISDKQLEEREHTIEQWKELIYEEVID
WEERNKNGLMKEDCSDVASGSASQSSSANDISSMSTEHTLASDTDSSSIDTLTGPLDESQ
NT seq 1263 nt   +upstreamnt  +downstreamnt
atgagtgaggcggagggccagttctacagtgtccaggtgggggactccaccttcactgtg
ctcaagcgttaccagcagcttcgtgccattggctcaggggcccaaggcattgtctgctct
gctctggatacagtcctcggtataccagtggctgtgaagaagctctgtcggccctttcag
aaccagacccatgcaaagcgggcctacagggaactggtgctgctgaaatgtgtcaaccac
aaaaatatcatccgtctgatcaatgttttcacgcctcagaagtctctggaggagttccag
gatctttacctggtgatggagctgatggatgccagcttatgtcaggtgattcacatggac
ctggaccacgagaggatgtcctacctgctctatcagatcctttgtggcatcaggcacctg
cactcagctgggatcatccacagagatctgaagcccagcaacattgttgtgaagtctgat
tgcactctgaaaatccttgacttcggtcttgcacggacagcttgcacaaacttcatgatg
accccctatgtagtaacccgatactaccgcgccccagaggtcattctgggcatgaagtat
aaggagaatgtggacatctggtcagtggggtgcatcatgggagagatggtaaaaggcagc
gtcatcttccagggcaccgatcacatcgaccagtggaataaagtgattgagattctgggt
acgcccagtctcgagtttatgaaccgactgatggagaccgtaaggaactatgtgatgaac
aagccgcagtatccaggcatcagcttcacagagctgttcccggattttgctttcccttct
gaatctgaacaagacaaagtgaaaaccgttcaagctcgggatctgctctccaaaatgctg
gtcattgatccggaatgccgtatctcggtagaggaagcccttcatcacccctacatccac
gtgtggtacgaccctgcagaggcggacgcgcctcctcctcagatttcagataagcagctg
gaagagagagagcacaccatcgagcagtggaaagaacttatttatgaagaagtgatagac
tgggaggagaggaacaagaacggtctaatgaaagaagactgctcagatgtggcgtccggt
tccgcttcccagtcgtcctcggccaacgacatttcgtccatgtccacagagcacacgctg
gcgtcggacacagacagcagcagcatcgacacgctgacagggccgctcgacgagagtcag
tga

KEGG   Xiphophorus couchianus (Monterrey platyfish): 114150017
Entry
114150017         CDS       T05908                                 

Gene name
mapk10
Definition
(RefSeq) mitogen-activated protein kinase 10 isoform X1
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04010  MAPK signaling pathway
xco04012  ErbB signaling pathway
xco04068  FoxO signaling pathway
xco04137  Mitophagy - animal
xco04140  Autophagy - animal
xco04141  Protein processing in endoplasmic reticulum
xco04210  Apoptosis
xco04217  Necroptosis
xco04310  Wnt signaling pathway
xco04510  Focal adhesion
xco04530  Tight junction
xco04620  Toll-like receptor signaling pathway
xco04621  NOD-like receptor signaling pathway
xco04622  RIG-I-like receptor signaling pathway
xco04625  C-type lectin receptor signaling pathway
xco04910  Insulin signaling pathway
xco04912  GnRH signaling pathway
xco04914  Progesterone-mediated oocyte maturation
xco04920  Adipocytokine signaling pathway
xco05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:xco00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    114150017 (mapk10)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    114150017 (mapk10)
   04012 ErbB signaling pathway
    114150017 (mapk10)
   04310 Wnt signaling pathway
    114150017 (mapk10)
   04068 FoxO signaling pathway
    114150017 (mapk10)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    114150017 (mapk10)
   04137 Mitophagy - animal
    114150017 (mapk10)
  09143 Cell growth and death
   04210 Apoptosis
    114150017 (mapk10)
   04217 Necroptosis
    114150017 (mapk10)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    114150017 (mapk10)
   04530 Tight junction
    114150017 (mapk10)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    114150017 (mapk10)
   04621 NOD-like receptor signaling pathway
    114150017 (mapk10)
   04622 RIG-I-like receptor signaling pathway
    114150017 (mapk10)
   04625 C-type lectin receptor signaling pathway
    114150017 (mapk10)
  09152 Endocrine system
   04910 Insulin signaling pathway
    114150017 (mapk10)
   04920 Adipocytokine signaling pathway
    114150017 (mapk10)
   04912 GnRH signaling pathway
    114150017 (mapk10)
   04914 Progesterone-mediated oocyte maturation
    114150017 (mapk10)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    114150017 (mapk10)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:xco01001]
    114150017 (mapk10)
Enzymes [BR:xco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     114150017 (mapk10)
Protein kinases [BR:xco01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   114150017 (mapk10)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like RIO1 APH FTA2
Other DBs
NCBI-GeneID: 114150017
NCBI-ProteinID: XP_027881985
LinkDB
Position
8
AA seq 467 aa
MVFMSRHFLYNCSQPVLDVKIAFCQGFGKQVDVSYIAKHYNMSKSKVDNQFYSVEVGDST
FTVLKRYQNLKPIGSGAQGIVCAGYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKC
VNHKNIISLLNVFTPQKSLEEFQDVYLVMELMDANLCQVIQMELDHERMSYLLYQMLCGI
KHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILG
MGYKENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQLGTPSPEFMKKLQPTVRNY
VENRPKYAGLTFPKLFPDCLFPADSEHNKLKASQARDLLSKMLIIDPAKRISVDEALQHP
YINVWYDPAEVEAPPPQIYDKQLDEREHSIDEWKELIYKEVMNFEERTKNGVVKGQPSPS
GAAVNSSESLPPSSSINDISSMSTDQTLASDTDSSLETSTGPLGCCR
NT seq 1404 nt   +upstreamnt  +downstreamnt
atggtatttatgagcagacatttcttatataactgcagccaaccagtcctggatgtaaag
atagctttttgtcagggttttggcaaacaagtggatgtgtcatatattgccaaacattac
aacatgagcaaaagcaaagtggacaaccagttctacagtgtggaagtgggagactccacc
ttcacagttctaaagcgttaccagaatttaaagcccattggttctggagctcagggaatt
gtctgtgcgggctatgatgctgtcctggacaggaatgtagccataaagaaactgagcaga
cccttccagaaccagacccacgccaagagggcataccgggagttggtgctcatgaaatgt
gtcaatcacaaaaatataatcagtttattaaatgtcttcacgccacagaaatcattagag
gaattccaagatgtgtaccttgtgatggagcttatggatgccaatttgtgccaggtgatt
cagatggagcttgaccacgagagaatgtcctatctgctctaccagatgttatgtggtatc
aaacatctgcactcagccggcattattcacagggatctcaaaccaagcaatatagtggta
aagtctgattgcaccctgaagatcctggacttcggtctggctagaaccgcgggcactagt
ttcatgatgaccccatatgtggtgacgcgatactacagagccccagaggtcatcctggga
atgggatacaaagaaaatgtggatatttggtcggtggggtgcatcatgggagaaatggtg
cgccacaaaatccttttccctggccgggattacattgaccagtggaacaaggtgatagag
cagctgggcacgccctctccagagttcatgaagaagctgcagcccacggtgaggaactac
gtggagaaccggccaaagtacgcgggcctcactttccccaagctcttccccgactgcctt
ttccctgctgactctgagcacaacaaactcaaagcaagccaggccagagacctgctgtct
aagatgctgatcatcgaccctgctaagcggatatcagtggacgaggccttacagcacccc
tacatcaacgtgtggtacgatccagctgaggtggaggcgcctccacctcagatttatgac
aagcagctggatgaacgagaacactctatagatgagtggaaagaactaatctacaaagag
gtgatgaactttgaggaaagaacgaagaatggcgttgtgaagggacagccttcaccttca
ggtgcagccgtgaacagcagcgagagcctccctccctcctcctctatcaacgacatctcc
tccatgtccaccgaccagaccctggcttcagacactgacagcagcctggagacctccacg
ggacccctggggtgctgcaggtga

KEGG   Xiphophorus couchianus (Monterrey platyfish): 114151722
Entry
114151722         CDS       T05908                                 

Definition
(RefSeq) mitogen-activated protein kinase 8 isoform X1
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco04010  MAPK signaling pathway
xco04012  ErbB signaling pathway
xco04068  FoxO signaling pathway
xco04137  Mitophagy - animal
xco04140  Autophagy - animal
xco04141  Protein processing in endoplasmic reticulum
xco04210  Apoptosis
xco04217  Necroptosis
xco04310  Wnt signaling pathway
xco04510  Focal adhesion
xco04530  Tight junction
xco04620  Toll-like receptor signaling pathway
xco04621  NOD-like receptor signaling pathway
xco04622  RIG-I-like receptor signaling pathway
xco04625  C-type lectin receptor signaling pathway
xco04910  Insulin signaling pathway
xco04912  GnRH signaling pathway
xco04914  Progesterone-mediated oocyte maturation
xco04920  Adipocytokine signaling pathway
xco05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:xco00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    114151722
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    114151722
   04012 ErbB signaling pathway
    114151722
   04310 Wnt signaling pathway
    114151722
   04068 FoxO signaling pathway
    114151722
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    114151722
   04137 Mitophagy - animal
    114151722
  09143 Cell growth and death
   04210 Apoptosis
    114151722
   04217 Necroptosis
    114151722
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    114151722
   04530 Tight junction
    114151722
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    114151722
   04621 NOD-like receptor signaling pathway
    114151722
   04622 RIG-I-like receptor signaling pathway
    114151722
   04625 C-type lectin receptor signaling pathway
    114151722
  09152 Endocrine system
   04910 Insulin signaling pathway
    114151722
   04920 Adipocytokine signaling pathway
    114151722
   04912 GnRH signaling pathway
    114151722
   04914 Progesterone-mediated oocyte maturation
    114151722
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    114151722
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:xco01001]
    114151722
Enzymes [BR:xco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     114151722
Protein kinases [BR:xco01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   114151722
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo APH RIO1 Kinase-like
Other DBs
NCBI-GeneID: 114151722
NCBI-ProteinID: XP_027884884
LinkDB
Position
10
AA seq 439 aa
MNRNKREKEYYSIDVGDSTFTVLKRYQNLRPIGSGAQGIVCSAYDHNLERNVAIKKLSRP
FQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIQ
MELDHERLSYLLYQMLCGIKHLHAAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAATGL
LMTPYVVTRYYRAPEVILGMGYQANVDVWSVGCIMAEMVRGSVLFPGTDHIDQWNKVIEQ
LGTPSQEFLMKLNQSVRTYVENRPRYAGYSFEKLFPDVLFPADSEHNKLKASQARDLLSK
MLVIDASKRISVDEALQHPYINVWYDPTEVEAPPPAITDKQLDEREHTVEEWKELIYKEV
LDWEERTKNGVIRGQPASIGAAVNSSPQQQHQHHPSTSSSSDPTLTDTDSSLETAPGPAG
PPGSAGPAAKAGGPVGCCR
NT seq 1320 nt   +upstreamnt  +downstreamnt
atgaaccggaacaagcgtgaaaaggagtattacagcatagacgtgggcgattcaactttt
acagtcctgaagcgctaccagaacctcagacctattggatccggagcacaggggattgtc
tgttcagcgtatgaccacaacttggagaggaacgttgccatcaagaagctgagccggccc
ttccagaaccaaacccacgccaagcgggcctacagggagctggtgctcatgaaatgtgtc
aaccacaagaacatcatcggcctgttaaacgtattcacgcctcagaagacactggaggag
ttccaagatgtgtatctagtgatggagctgatggacgccaacctgtgtcaagtgattcag
atggagctggaccacgagaggctgtcctacctgctctaccagatgctgtgtgggattaaa
cacctccatgctgcaggcatcatacacagggacctgaagcccagcaacattgtagtaaag
tctgactgcacactgaagatcctggactttggcctggccaggaccgctgccaccggcctc
ctcatgacgccctacgtagtgacccgttactaccgtgcccccgaggtcatcctgggcatg
ggttaccaggccaacgttgatgtctggtctgttggatgcatcatggctgaaatggtccga
ggtagtgtgttgtttccaggcactgatcacattgaccagtggaacaaggtgatcgagcag
ctggggacgccgtctcaggagttcctcatgaagctcaaccagtcggtgaggacctacgtg
gagaaccggccgcgttacgccggctacagctttgagaagctcttccccgatgtcctgttc
cctgctgactctgaacacaacaagttgaaagcgagccaagccagggaccttctatccaaa
atgctggtaatagacgcttctaagcggatctctgtggacgaggctctccagcacccttac
attaatgtgtggtacgatccgactgaagtggaggcaccgccgcccgccatcacagacaag
cagctggacgagcgggagcacacagtggaggagtggaaagagttgatatataaagaagtg
ctggactgggaggaaaggacgaagaatggtgtcatcaggggacagcctgcatccataggt
gcagcagtgaacagcagccctcagcagcagcaccagcaccatccctccacgtcctcatcc
tccgaccccaccctgaccgacacggacagcagcctggagacggcccccggccccgcgggc
cccccgggctccgcaggccccgctgccaaggccggcggccccgtgggctgctgcagatga

DBGET integrated database retrieval system