KEGG   Xiphophorus couchianus (Monterrey platyfish): 114137824Help
Entry
114137824         CDS       T05908                                 

Definition
(RefSeq) glutathione S-transferase omega-1-like
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
xco  Xiphophorus couchianus (Monterrey platyfish)
Pathway
xco00480  Glutathione metabolism
xco00980  Metabolism of xenobiotics by cytochrome P450
xco00982  Drug metabolism - cytochrome P450
xco00983  Drug metabolism - other enzymes
xco01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xco00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    114137824
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    114137824
   00982 Drug metabolism - cytochrome P450
    114137824
   00983 Drug metabolism - other enzymes
    114137824
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:xco02000]
    114137824
Enzymes [BR:xco01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     114137824
Transporters [BR:xco02000]
 Other Transporters
  Pores ion channels [TC:1]
   114137824
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C GST_C_3 GST_C_2 Glutaredoxin GST_C_6 GST_C_5 UPF0270
Motif
Other DBs
NCBI-GeneID: 114137824
NCBI-ProteinID: XP_027862459
LinkDB All DBs
Position
22
AA seq 239 aa AA seqDB search
MATEKCFAKGSPAPGPVPKGQLHLYSMRFCPFAQRTRLALNSKGIKYDTININLKEKPEW
FLEKNPLGLVPALETSAGEVIYESSITCEYLDEAYPEKKLLPSSPFGKAQQRMLLEHFSK
VIPYFYKIPSARRTGEDVSTQEVELKEKFAKLNEHLEKKKTKFFEGDTITMIDYMMWPFF
ERIEVLELKHCLDHTPELKKWTERMLEDPAVKATMFNMDTHKAFYKSVAEGKPDYDLGL
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atggctactgaaaaatgtttcgctaaaggaagccctgcacctggccctgttcccaaaggt
caactgcatctctacagcatgagattttgcccttttgctcaaaggaccagattagcgctg
aattccaaagggatcaaatatgacaccatcaacatcaatttgaaagagaaacccgagtgg
tttcttgaaaagaaccctctcggtcttgtgcctgcactggagacatctgctggtgaagtt
atatacgagtcttccatcacctgtgagtatctggatgaagcgtatcctgagaaaaagctt
cttccatcctctccttttggaaaagcccaacaaagaatgctgctggagcatttttccaag
gtaataccttacttctacaagatcccttcagcaagaaggactggagaggatgtctctaca
caggaagttgagctgaaagagaaatttgctaaattgaatgagcacttggagaagaaaaag
acaaagttctttgaaggtgacaccatcacaatgatcgactacatgatgtggccatttttt
gagaggattgaggtcttggagctgaagcactgcctggaccacactcctgagctgaagaag
tggactgagcgcatgctggaggatccagctgttaaagccaccatgttcaacatggacacc
cacaaagccttctacaagagcgttgctgaggggaaacccgactatgacctcggcctgtaa

DBGET integrated database retrieval system